SKP2/p45 Antibody - #AF0505

(5)   (7)  
Product: SKP2/p45 Antibody
Catalog: AF0505
Description: Rabbit polyclonal antibody to SKP2/p45
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 47kDa; 48kD(Calculated).
Uniprot: Q13309
RRID: AB_2834158

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Prediction:
Pig(100%), Bovine(100%), Horse(90%), Sheep(100%), Rabbit(100%), Dog(90%), Chicken(80%)
Clonality:
Polyclonal
Specificity:
SKP2/p45 Antibody detects endogenous levels of total SKP2/p45.
RRID:
AB_2834158
Cite Format: Affinity Biosciences Cat# AF0505, RRID:AB_2834158.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CDK2/Cyclin A associated protein p45; Cyclin A/CDK2 associated protein p45; Cyclin-A/CDK2-associated protein p45; F box protein Skp2; F box/LRR repeat protein 1; F-box protein Skp2; F-box/LRR-repeat protein 1; FBL 1; FBL1; FBXL 1; FBXL1; FLB 1; FLB1; MGC1366; p45; p45skp2; S phase kinase associated protein 2 (p45); S phase kinase associated protein 2; S-phase kinase-associated protein 2; S-phase kinase-associated protein 2 E3 ubiquitin protein ligase; SKP 2; Skp2; SKP2_HUMAN;

Immunogens

Immunogen:

A synthesized peptide derived from human SKP2/p45, corresponding to a region within C-terminal amino acids.

Uniprot:

Q13309(SKP2_HUMAN) >>Visit HPA database.

Gene(ID):
SKP2(6502)
Description:
SKP2 an F-box protein of the SCF (SKP1-CUL1-F- box protein) E3 ubiquitin ligase system. The F-box component of the SCF complex is responsible for recognizing different substrates for ubiquitination. The SCF E3 complex mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Specifically recognizes phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. Degradation of CDKN1B/p27kip also requires CKS1. Three alternatively-spliced isoforms have been described.
Sequence:
MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
100
Sheep
100
Rabbit
100
Horse
90
Dog
90
Chicken
80
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Specifically recognizes phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. Degradation of CDKN1B/p27kip also requires CKS1. Recognizes target proteins ORC1, CDT1, RBL2, KMT2A/MLL1, CDK9, RAG2, FOXO1, UBP43, and probably MYC, TOB1 and TAL1. Degradation of TAL1 also requires STUB1. Recognizes CDKN1A in association with CCNE1 or CCNE2 and CDK2. Promotes ubiquitination and destruction of CDH1 in a CK1-Dependent Manner, thereby regulating cell migration.

Through the ubiquitin-mediated proteasomal degradation of hepatitis C virus non-structural protein 5A, has an antiviral activity towards that virus.

PTMs:

Ubiquitinated by the APC/C complex, leading to its degradation by the proteasome. Deubiquitinated by USP13.

Acetylation at Lys-68 and Lys-71 increases stability through impairment of APC/C-mediated proteolysis and promotes cytoplasmic retention. Deacetylated by SIRT3.

Subcellular Location:

Cytoplasm. Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

· Environmental Information Processing > Signal transduction > FoxO signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > mTOR signaling pathway.   (View pathway)

· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis.   (View pathway)

· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.

· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

· Human Diseases > Cancers: Specific types > Small cell lung cancer.   (View pathway)

References

1). Bexarotene improves motor function after spinal cord injury in mice. Neural Regeneration Research, 2023 (PubMed: 37449638) [IF=5.9]

Application: WB    Species: Mouse    Sample: spinal cord

Figure 10 Bexarotene activates TFE3 through the AMPK-mTOR and AMPK-SPK2- CARM1 signaling pathways in SCI. (A) Western blot assay of the cytoplasmic expression levels of AMPK, p-AMPK, mTOR, and p-mTOR. (B) Quantification of AMPK, p-AMPK, mTOR, and p-mTOR from A, normalized to GADPH. (C) Western blot assay of the nuclear expression levels of AMPK, p-AMPK, FOXO3a, p-FOXO3a, SKP2, and CARM1. (D) Quantification of AMPK, p-AMPK, FOXO3a, p-FOXO3a, SKP2, and CARM1 from C, normalized to H3. (E, F) Immunoprecipitation images showing nuclear CARM1–TFE3 binding. Data are expressed as the mean ± SEM (n = 6 per group). **P < 0.01, vs. SCI group; ##P < 0.01, vs. SCI + Bex group. One-way analysis of variance with least significance difference post hoc test. (p-)AMPK: (phospho-) adenosine 5′-monophosphate-activated protein kinase; (p-)FOXO3a: (phospho-)forkhead box O3; (p-)mTOR: (phospho-)mammalian target of rapamycin; Bex: bexarotene; CARM1: coactivator-associated arginine methyltransferase 1; CC: compound C; GAPDH: glyceraldehyde-3-phosphate dehydrogenase; H3: histone protein H3; SCI: spinal cord injury; SKP2: S-phase kinase-associated protein 2; TFE3: transcription factor E3.
2). 贝沙罗汀改善脊髓损伤后运动功能的机制. 中国神经再生研究(英文版), 2023 (PubMed: 37449638) [IF=5.9]

Application: WB    Species: Mouse    Sample:

Figure 10 Bexarotene activates TFE3 through the AMPK-mTOR and AMPK-SPK2- CARM1 signaling pathways in SCI. (A) Western blot assay of the cytoplasmic expression levels of AMPK, p-AMPK, mTOR, and p-mTOR. (B) Quantification of AMPK, p-AMPK, mTOR, and p-mTOR from A, normalized to GADPH. (C) Western blot assay of the nuclear expression levels of AMPK, p-AMPK, FOXO3a, p-FOXO3a, SKP2, and CARM1. (D) Quantification of AMPK, p-AMPK, FOXO3a, p-FOXO3a, SKP2, and CARM1 from C, normalized to H3. (E, F) Immunoprecipitation images showing nuclear CARM1–TFE3 binding. Data are expressed as the mean ± SEM (n = 6 per group). **P < 0.01, vs. SCI group; ##P < 0.01, vs. SCI + Bex group. One-way analysis of variance with least significance difference post hoc test. (p-)AMPK: (phospho-) adenosine 5′-monophosphate-activated protein kinase; (p-)FOXO3a: (phospho-)forkhead box O3; (p-)mTOR: (phospho-)mammalian target of rapamycin; Bex: bexarotene; CARM1: coactivator-associated arginine methyltransferase 1; CC: compound C; GAPDH: glyceraldehyde-3-phosphate dehydrogenase; H3: histone protein H3; SCI: spinal cord injury; SKP2: S-phase kinase-associated protein 2; TFE3: transcription factor E3.
3). Calycosin inhibited autophagy and oxidative stress in chronic kidney disease skeletal muscle atrophy by regulating AMPK/SKP2/CARM1 signalling pathway. JOURNAL OF CELLULAR AND MOLECULAR MEDICINE, 2020 (PubMed: 32910538) [IF=5.3]

Application: WB    Species: rat    Sample: muscles

FIGURE 5|Effect of calycosin on the expression of CARM1 and H3R17me2a,and related proteins in rat muscles. A-B,Representative images and scores of the expression of CARM1 and H3R17me2a in muscle sections using IHC staining (×200).Bar = 50 µm. *P < 0.05 compared to the sham group. ##P < 0.01 compared to the 5/6 Nx model group. C-E, Representative immune blots of key proteins involved in muscle atrophy and proteins associated with the AMPK/SKP2/CARM1 signalling pathway
4). S-phase kinase-associated protein 2 impairs the inhibitory effects of miR-1236-3p on bladder tumors. American Journal of Translational Research, 2018 (PubMed: 29636863) [IF=1.7]

Application: WB    Species: human    Sample: 5637, T24, EJ and J82 cells and SV-HUC-1

Figure 1. |Skp2 is over-expressed in BCa samples and cell lines.(E) Skp2 mRNA and protein (G) expression was increased in 5637, T24, EJ and J82 cell lines compared with primary normal human bladder epithelial cells (SV-HUC-1), (*P<0.05, **P<0.01). GAPDH levels were used as an internal control.
5). WISP2/CCN5 gene knockdown in vitro and in vivo exhibits proliferation promotion of breast cancer through targeting Skp2 and p27Kip1. bioRxiv, 2020

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.