Product: NEDD8 Antibody
Catalog: AF0271
Description: Rabbit polyclonal antibody to NEDD8
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat, Monkey
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 85kDa; 9kD(Calculated).
Uniprot: Q15843
RRID: AB_2833352

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Monkey
Prediction:
Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
NEDD8 Antibody detects endogenous levels of total NEDD8.
RRID:
AB_2833352
Cite Format: Affinity Biosciences Cat# AF0271, RRID:AB_2833352.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

FLJ43224; MGC104393; MGC125896; MGC125897; NED8; NEDD 8; NEDD-8; Nedd8; NEDD8_HUMAN; Neddylin; Neural precursor cell expressed developmentally down regulated 8; Neural precursor cell expressed developmentally down regulated gene 8; Neural precursor cell expressed developmentally down-regulated protein 8; Rub1; Ubiquitin like protein Nedd 8; Ubiquitin like protein Nedd8; Ubiquitin-like protein Nedd8;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q15843 NEDD8_HUMAN:

Highly expressed in heart, skeletal muscle, spleen, thymus, prostate, testis, ovary, colon and leukocytes.

Description:
NEDD8 a member of the ubiquitin family of proteins. Approximately 60% identical to ubiquitin protein.. Activated by an E1-like complex, consisting of App-b1 and Uba3 and then linked to the E2-like enzyme, Ubc12. The major target protein modified by nedd8 is cullin-4a.
Sequence:
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Zebrafish
100
Chicken
100
Rabbit
100
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q15843 As Substrate

Site PTM Type Enzyme
K4 Ubiquitination
K6 Ubiquitination
T7 Phosphorylation
T9 Phosphorylation
K11 Acetylation
K11 Sumoylation
K11 Ubiquitination
T20 Phosphorylation
K22 Ubiquitination
K27 Ubiquitination
K33 Ubiquitination
Y45 Phosphorylation
S46 Phosphorylation
K48 Acetylation
K48 Sumoylation
K48 Ubiquitination
K54 Acetylation
K54 Ubiquitination
Y59 Phosphorylation
K60 Ubiquitination
S65 Phosphorylation

Research Backgrounds

Function:

Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins.

PTMs:

Cleavage of precursor form by UCHL3 or SENP8 is necessary for function.

Subcellular Location:

Nucleus.
Note: Mainly nuclear.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly expressed in heart, skeletal muscle, spleen, thymus, prostate, testis, ovary, colon and leukocytes.

Subunit Structure:

Directly interacts with NUB1 and AHR. Covalently attached to cullins and p53.

Family&Domains:

Belongs to the ubiquitin family.

References

1). Xiaowei Qin et al. Neddylation inactivation affects cell cycle and apoptosis in sheep follicular granulosa cells. Journal of Cellular Physiology 2022 May 16. (PubMed: 35578798) [IF=5.6]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.