CIB2 Antibody - #AF0349
| Product: | CIB2 Antibody |
| Catalog: | AF0349 |
| Description: | Rabbit polyclonal antibody to CIB2 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 21kDa; 22kD(Calculated). |
| Uniprot: | O75838 |
| RRID: | AB_2834187 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0349, RRID:AB_2834187.
Fold/Unfold
Calcium and integrin binding protein 2; Calcium and integrin-binding family member 2; Cib2; CIB2_HUMAN; DNA dependent protein kinase interacting protein 2; Kinase interacting protein 2; Kinase-interacting protein 2; KIP 2;
Immunogens
- O75838 CIB2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O75838 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T6 | Phosphorylation | Uniprot | |
| T9 | Phosphorylation | Uniprot | |
| T20 | Phosphorylation | Uniprot | |
| S49 | Phosphorylation | Uniprot | |
| S57 | Phosphorylation | Uniprot |
Research Backgrounds
Calcium-binding protein critical for proper photoreceptor cell maintenance and function. Plays a role in intracellular calcium homeostasis by decreasing ATP-induced calcium release. May be involved in the mechanotransduction process (By similarity).
Cytoplasm. Cell projection>Stereocilium. Photoreceptor inner segment. Cell projection>Cilium>Photoreceptor outer segment. Cell membrane>Sarcolemma.
Note: Colocalized with ITGA7 at the myotendinous junctions (MTJ) and at the neuromuscular junctions (NMJ) (By similarity). Localizes in the cuticular plate along and at the tip of the stereocilia of vestibular sensory hair cells (PubMed:26173970, PubMed:26426422).
Widely expressed.
Homodimer. Interacts with WHRN and MYO7A. Interacts with ITGA2B (via C-terminus cytoplasmic tail region) and ITGA7 (via C-terminus cytoplasmic tail region); the interactions are stabilized/increased in a calcium and magnesium-dependent manner.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.