DCP1A Antibody - #AF0551
Product: | DCP1A Antibody |
Catalog: | AF0551 |
Description: | Rabbit polyclonal antibody to DCP1A |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 75kDa; 63kD(Calculated). |
Uniprot: | Q9NPI6 |
RRID: | AB_2834222 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0551, RRID:AB_2834222.
Fold/Unfold
DCP1 decapping enzyme homolog A; Dcp1a; DCP1A_HUMAN; Decapping enzyme hDcp1a; Decapping mRNA 1A; HSA275986; mRNA decapping enzyme 1A; mRNA-decapping enzyme 1A; Nbla00360; Putative protein product of Nbla00360; Smad4 interacting transcriptional co activator; Smad4-interacting transcriptional co-activator; Smad4-interacting transcriptional co-activator; SMAD4IP1; SMIF; Transcription factor SMIF;
Immunogens
A synthesized peptide derived from human DCP1A, corresponding to a region within the internal amino acids.
Detected in heart, brain, placenta, lung, skeletal muscle, liver, kidney and pancreas.
- Q9NPI6 DCP1A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPRQRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Contributes to the transactivation of target genes after stimulation by TGFB1.
Cytoplasm>P-body. Nucleus.
Note: Co-localizes with NANOS3 in the processing bodies (By similarity). Predominantly cytoplasmic, in processing bodies (PB) (PubMed:16364915). Nuclear, after TGFB1 treatment. Translocation to the nucleus depends on interaction with SMAD4 (PubMed:11836524).
Detected in heart, brain, placenta, lung, skeletal muscle, liver, kidney and pancreas.
Belongs to the DCP1 family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > RNA degradation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.