Product: CKS2 Antibody
Catalog: AF0616
Description: Rabbit polyclonal antibody to CKS2
Application: WB IHC IF/ICC
Reactivity: Human, Mouse
Prediction: Pig, Zebrafish, Bovine, Sheep, Dog, Chicken, Xenopus
Mol.Wt.: 9kDa; 10kD(Calculated).
Uniprot: P33552
RRID: AB_2834233

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IHC 1:50-1:200, WB 1:500-1:2000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Prediction:
Pig(100%), Zebrafish(91%), Bovine(100%), Sheep(100%), Dog(100%), Chicken(92%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
CKS2 Antibody detects endogenous levels of total CKS2.
RRID:
AB_2834233
Cite Format: Affinity Biosciences Cat# AF0616, RRID:AB_2834233.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CDC28; CDC28 protein kinase 2; CDC28 protein kinase regulatory subunit 2; CKS 2; CKS-2; CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog 2; Cks2; CKS2_HUMAN; CKSHS2; Cyclin dependent kinases regulatory subunit 2; Cyclin-dependent kinases regulatory subunit 2;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein.
Sequence:
MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Chicken
92
Zebrafish
91
Horse
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P33552 As Substrate

Site PTM Type Enzyme
K4 Acetylation
K4 Ubiquitination
Y7 Phosphorylation
Y8 Phosphorylation
K11 Ubiquitination
Y12 Phosphorylation
Y17 Phosphorylation
K30 Ubiquitination
K34 Ubiquitination
S39 Phosphorylation
S51 Phosphorylation

Research Backgrounds

Function:

Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.

Subunit Structure:

Forms a homohexamer that can probably bind six kinase subunits.

Family&Domains:

Belongs to the CKS family.

Research Fields

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Small cell lung cancer.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.