Phospho-PTP1B (Tyr66) Antibody - #AF8305
| Product: | Phospho-PTP1B (Tyr66) Antibody |
| Catalog: | AF8305 |
| Description: | Rabbit polyclonal antibody to Phospho-PTP1B (Tyr66) |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 49kDa; 50kD(Calculated). |
| Uniprot: | P18031 |
| RRID: | AB_2840367 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF8305, RRID:AB_2840367.
Fold/Unfold
PTP1B; Non receptor tyrosine phosphatase 1; Protein phosphotyrosylphosphatase 1B; Protein tyrosine phosphatase 1B; Protein tyrosine phosphatase non receptor type 1; Protein tyrosine phosphatase placental; Protein-tyrosine phosphatase 1B; PTN1_HUMAN; PTP 1B; PTP-1B; PTPN 1; PTPN1; Tyrosine protein phosphatase non receptor type 1; Tyrosine-protein phosphatase non-receptor type 1;
Immunogens
A synthesized peptide derived from human PTP1B around the phosphorylation site of Tyr66.
- P18031 PTN1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Tyrosine-protein phosphatase which acts as a regulator of endoplasmic reticulum unfolded protein response. Mediates dephosphorylation of EIF2AK3/PERK; inactivating the protein kinase activity of EIF2AK3/PERK. May play an important role in CKII- and p60c-src-induced signal transduction cascades. May regulate the EFNA5-EPHA3 signaling pathway which modulates cell reorganization and cell-cell repulsion. May also regulate the hepatocyte growth factor receptor signaling pathway through dephosphorylation of MET.
Oxidized on Cys-215; the Cys-SOH formed in response to redox signaling reacts with the alpha-amido of the following residue to form a sulfenamide cross-link, triggering a conformational change that inhibits substrate binding and activity. The active site can be restored by reduction.
Ser-50 is the major site of phosphorylation as compared to Ser-242 and Ser-243. Activated by phosphorylation at Ser-50.
S-nitrosylation of Cys-215 inactivates the enzyme activity.
Sulfhydration at Cys-215 following endoplasmic reticulum stress inactivates the enzyme activity, promoting EIF2AK3/PERK activity.
Endoplasmic reticulum membrane>Peripheral membrane protein>Cytoplasmic side.
Note: Interacts with EPHA3 at the cell membrane.
Expressed in keratinocytes (at protein level).
Belongs to the protein-tyrosine phosphatase family. Non-receptor class 1 subfamily.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Adherens junction. (View pathway)
· Human Diseases > Endocrine and metabolic diseases > Insulin resistance.
· Organismal Systems > Endocrine system > Insulin signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.