TAS2R47 Antibody - #DF10304
| Product: | TAS2R47 Antibody |
| Catalog: | DF10304 |
| Description: | Rabbit polyclonal antibody to TAS2R47 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 37 kDa; 37kD(Calculated). |
| Uniprot: | P59541 |
| RRID: | AB_2840882 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10304, RRID:AB_2840882.
Immunogens
A synthesized peptide derived from human TAS2R47, corresponding to a region within the internal amino acids.
Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells.
- P59541 T2R30_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MITFLPIIFSILIVVIFVIGNFANGFIALVNSIEWVKRQKISFVDQILTALAVSRVGLLWVLLLHWYATQLNPAFYSVEVRITAYNVWAVTNHFSSWLATSLSMFYLLRIANFSNLIFLRIKRRVKSVVLVILLGPLLFLVCHLFVINMDETVWTKEYEGNVTWKIKLRSAMYHSNMTLTMLANFVPLTLTLISFLLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVTSFLLLCAIYFLSMIISVCNFGRLEKQPVFMFCQAIIFSYPSTHPFILILGNKKLKQIFLSVLRHVRYWVKDRSLRLHRFTRGALCVF
Research Backgrounds
Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity).
Membrane>Multi-pass membrane protein.
Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells.
Belongs to the G-protein coupled receptor T2R family.
Research Fields
· Organismal Systems > Sensory system > Taste transduction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.