Product: Phospho-FADD (Ser194) Antibody
Catalog: DF2996
Description: Rabbit polyclonal antibody to Phospho-FADD (Ser194)
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 23KD(Observed); 23kD(Calculated).
Uniprot: Q13158
RRID: AB_2840975

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Phospho-FADD (Ser194) Antibody detects endogenous levels of FADD only when phosphorylated at Ser194.
RRID:
AB_2840975
Cite Format: Affinity Biosciences Cat# DF2996, RRID:AB_2840975.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

FADD; FADD protein; FADD_HUMAN; Fas (TNFRSF6) associated via death domain; Fas associated via death domain; Fas associating death domain containing protein; Fas associating protein; Fas associating protein with death domain; Fas TNFRSF6 associated via death domain; FAS-associated death domain protein; FAS-associating death domain-containing protein; GIG 3; GIG3; Growth inhibiting gene 3 protein; Growth-inhibiting gene 3 protein; H sapiens mRNA for mediator of receptor induced toxicity; Mediator of receptor induced toxicity; MGC8528; MORT 1; MORT1; Protein FADD;

Immunogens

Immunogen:

A synthesized peptide derived from human FADD around the phosphorylation site of Ser194.

Uniprot:
Gene(ID):
Expression:
Q13158 FADD_HUMAN:

Expressed in a wide variety of tissues, except for peripheral blood mononuclear leukocytes.

Sequence:
MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS

Research Backgrounds

Function:

Apoptotic adaptor molecule that recruits caspase-8 or caspase-10 to the activated Fas (CD95) or TNFR-1 receptors. The resulting aggregate called the death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation. Active caspase-8 initiates the subsequent cascade of caspases mediating apoptosis. Involved in interferon-mediated antiviral immune response, playing a role in the positive regulation of interferon signaling.

Tissue Specificity:

Expressed in a wide variety of tissues, except for peripheral blood mononuclear leukocytes.

Family&Domains:

Contains a death domain involved in the binding of the corresponding domain within Fas receptor.

The interaction between the FAS and FADD death domains is crucial for the formation of the death-inducing signaling complex (DISC).

Research Fields

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis - multiple species.   (View pathway)

· Cellular Processes > Cell growth and death > Necroptosis.   (View pathway)

· Environmental Information Processing > Signal transduction > TNF signaling pathway.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.

· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.

· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).

· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Organismal Systems > Immune system > Toll-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > NOD-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > RIG-I-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > IL-17 signaling pathway.   (View pathway)

References

1). Nd:YAG1064nm laser functions against Sporothrix globosa by inducing PANoptosis via the regulation of ZBP1-induced PANoptosome activation. Frontiers in microbiology, 2025 (PubMed: 40207151) [IF=5.2]

2). MiR-21 attenuates FAS-mediated cardiomyocyte apoptosis by regulating HIPK3 expression. Bioscience reports, 2023 (PubMed: 37581369) [IF=3.8]

Application: WB    Species: Rat    Sample: H9C2 cell

Figure 6 (A) Representative images of Western blot analysis. (B–F) Statistical analysis of protein levels: HIPK3 down-regulation decreased the phosphorylation of FADD and the expression of BAX and C-Caspase-3, and increased the expression of BCL2 (n=3). In panels B,D,E, the gray values of bands were normalized to that of beta Actin. C-Caspase-3, cleaved caspase-3; p-FADD, phosphorylated FADD. Data are presented as mean ± SD; #P

3). Sulforaphene suppressed cell proliferation and promoted apoptosis of COV362 cells in endometrioid ovarian cancer. PeerJ, 2023 (PubMed: 38025760) [IF=2.3]

Application: WB    Species: human    Sample: COV362 cells

Figure 3: Effect of METTL3 on COV362 cell apoptosis. (A) Representative images of cell apoptosis in COV362 cells after silencing METTL3 or elevating METTL3 were analyzed by Tunel staining. Scale bar =50 µm. (B) FAS, FADD, p-FADD, Caspase-8, Caspase-3, Bcl-2, and Bax protein expressions were determined in COV362 cells with METTL3 knock-down or overexpression through western blotting. ▴P < 0.05, ▴▴P < 0.01 vs. si-NC group; ∗P < 0.05, ∗∗P < 0.01 vs. PcDNA3.1 group.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.