Product: FADD Antibody
Catalog: DF7674
Description: Rabbit polyclonal antibody to FADD
Application: WB IF/ICC
Cited expt.: WB
Reactivity: Human, Rat
Prediction: Bovine, Sheep
Mol.Wt.: 28 kDa(Observed); 23kD(Calculated).
Uniprot: Q13158
RRID: AB_2841146

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Rat
Prediction:
Bovine(100%), Sheep(%)
Clonality:
Polyclonal
Specificity:
FADD Antibody detects endogenous levels of total FADD.
RRID:
AB_2841146
Cite Format: Affinity Biosciences Cat# DF7674, RRID:AB_2841146.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

FADD; FADD protein; FADD_HUMAN; Fas (TNFRSF6) associated via death domain; Fas associated via death domain; Fas associating death domain containing protein; Fas associating protein; Fas associating protein with death domain; Fas TNFRSF6 associated via death domain; FAS-associated death domain protein; FAS-associating death domain-containing protein; GIG 3; GIG3; Growth inhibiting gene 3 protein; Growth-inhibiting gene 3 protein; H sapiens mRNA for mediator of receptor induced toxicity; Mediator of receptor induced toxicity; MGC8528; MORT 1; MORT1; Protein FADD;

Immunogens

Immunogen:

A synthesized peptide derived from human FADD, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
Q13158 FADD_HUMAN:

Expressed in a wide variety of tissues, except for peripheral blood mononuclear leukocytes.

Sequence:
MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Bovine
100
Sheep
100
Xenopus
75
Chicken
75
Pig
0
Horse
0
Dog
0
Zebrafish
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Apoptotic adaptor molecule that recruits caspase-8 or caspase-10 to the activated Fas (CD95) or TNFR-1 receptors. The resulting aggregate called the death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation. Active caspase-8 initiates the subsequent cascade of caspases mediating apoptosis. Involved in interferon-mediated antiviral immune response, playing a role in the positive regulation of interferon signaling.

Tissue Specificity:

Expressed in a wide variety of tissues, except for peripheral blood mononuclear leukocytes.

Family&Domains:

Contains a death domain involved in the binding of the corresponding domain within Fas receptor.

The interaction between the FAS and FADD death domains is crucial for the formation of the death-inducing signaling complex (DISC).

Research Fields

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis - multiple species.   (View pathway)

· Cellular Processes > Cell growth and death > Necroptosis.   (View pathway)

· Environmental Information Processing > Signal transduction > TNF signaling pathway.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.

· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.

· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).

· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Organismal Systems > Immune system > Toll-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > NOD-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > RIG-I-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > IL-17 signaling pathway.   (View pathway)

References

1). Extracellular vesicles of Fusobacterium nucleatum compromise intestinal barrier through targeting RIPK1-mediated cell death pathway. Gut Microbes, 2021 (PubMed: 33769187) [IF=12.2]

Application: WB    Species: human    Sample: Caco2 cells

Figure 3. |FnEVs potentiate caco-2 cells barrier loss through RIPK1-mediated cell death pathway. (a) Diagram of groups. (b) Apoptosis was analyzed by using the annexin V FITC/PI assay. (c) Bar graphs show the relative mean of Caco-2 cells apoptosis rate in different view fields. (d) The releasing levels of LDH were detected. (e) Representative images of TUNEL stainings of Caco-2 cells (green, TUNEL positive; blue, DAPI). Scale bar = 50 um. (f) Immunoblot analysis of protein extracts from Caco-2 cells with the indicated antibodies..

Application: IHC    Species: mouse    Sample: colon

Figure 6. |RIPK1 mediated epithelial cell death drives exacerbated barrier loss in FnEVs-treated colitis mice. (a) Representative images of TUNEL stainings of colon sections on day 3 after colitis induction (red, TUNEL positive; blue, DAPI). Scale bar = 50 um (up) or 20 um (down). (b) Representative images of immunohistochemical stainings of FADD, RIPK1 and cCASP3 in the colon sections on day 3 after colitis induction. Scale bar = 50 um or 20 um (downmost).

2). Patchouli oil ameliorates 5-fluorouracil-induced intestinal mucositis in rats via protecting intestinal barrier and regulating water transport. JOURNAL OF ETHNOPHARMACOLOGY, 2020 (PubMed: 31883475) [IF=4.8]

Application: WB    Species: rat    Sample: intestinal

Fig. 8.| Effect of P.oil on the expression of TLRs-MyD88 pathway-related proteins (n = 3–5). A: representative western blotting band; B: The expressions of MyD88(a),IRAK-4(b), FADD (c), TAK-1(d), p-p38/p38 (e) and p-p65/p65 (f).

3). Cecropin A Alleviates LPS-Induced Oxidative Stress and Apoptosis of Bovine Endometrial Epithelial Cells. Animals : an open access journal from MDPI, 2024 (PubMed: 38473153) [IF=2.7]

Application: WB    Species: bovine    Sample: bEECs

Figure 8 Protein levels of the apoptosis-related proteins in bEECs on the Fas/FasL-caspase-8/-3 pathway. (A) Western blot of the Caspase-8, FADD, Caspase-3, and cytochrome C proteins. (B) Relative levels of Caspase-8. (C) Relative levels of FADD. (D) Relative levels of Caspase-3. (E) Relative levels of cytochrome C.

4). Sulforaphene suppressed cell proliferation and promoted apoptosis of COV362 cells in endometrioid ovarian cancer. PeerJ, 2023 (PubMed: 38025760) [IF=2.3]

Application: WB    Species: human    Sample: COV362 cells

Figure 3: Effect of METTL3 on COV362 cell apoptosis. (A) Representative images of cell apoptosis in COV362 cells after silencing METTL3 or elevating METTL3 were analyzed by Tunel staining. Scale bar =50 µm. (B) FAS, FADD, p-FADD, Caspase-8, Caspase-3, Bcl-2, and Bax protein expressions were determined in COV362 cells with METTL3 knock-down or overexpression through western blotting. ▴P < 0.05, ▴▴P < 0.01 vs. si-NC group; ∗P < 0.05, ∗∗P < 0.01 vs. PcDNA3.1 group.

5). Passive smoking induces rat testicular injury via the FAS/FASL pathway. DRUG AND CHEMICAL TOXICOLOGY, 2022 (PubMed: 31476926) [IF=2.1]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.