Product: UGT2B Antibody
Catalog: DF7734
Description: Rabbit polyclonal antibody to UGT2B
Application: WB IHC
Reactivity: Human, Mouse
Mol.Wt.: 61 kDa(Observed); 61kD(Calculated).
Uniprot: O75795
RRID: AB_2841202

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
UGT2B Antibody detects endogenous levels of total UGT2B.
RRID:
AB_2841202
Cite Format: Affinity Biosciences Cat# DF7734, RRID:AB_2841202.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

C19 steroid specific UDP glucuronosyltransferase; C19 steroid specific UDPGT; UDB17; UDP glucuronosyltransferase 2B17; UDPGT 2B17;

Immunogens

Immunogen:

A synthesized peptide derived from human UGT2B, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
O75795 UDB17_HUMAN:

Expressed in various tissues including the liver, kidney, testis, uterus, placenta, mammary gland, adrenal gland, skin and prostate.

Sequence:
MSLKWMSVFLLMQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVIVLTSSASILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYTVEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATMIFMITKCCLFCFRKLAKTGKKKKRD

Research Backgrounds

Function:

UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. The major substrates of this isozyme are eugenol > 4-methylumbelliferone > dihydrotestosterone (DHT) > androstane-3-alpha,17-beta-diol (3-alpha-diol) > testosterone > androsterone (ADT).

Subcellular Location:

Microsome membrane>Single-pass membrane protein. Endoplasmic reticulum membrane>Single-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in various tissues including the liver, kidney, testis, uterus, placenta, mammary gland, adrenal gland, skin and prostate.

Family&Domains:

Belongs to the UDP-glycosyltransferase family.

Research Fields

· Human Diseases > Cancers: Overview > Chemical carcinogenesis.

· Metabolism > Carbohydrate metabolism > Pentose and glucuronate interconversions.

· Metabolism > Carbohydrate metabolism > Ascorbate and aldarate metabolism.

· Metabolism > Lipid metabolism > Steroid hormone biosynthesis.

· Metabolism > Metabolism of cofactors and vitamins > Retinol metabolism.

· Metabolism > Metabolism of cofactors and vitamins > Porphyrin and chlorophyll metabolism.

· Metabolism > Xenobiotics biodegradation and metabolism > Metabolism of xenobiotics by cytochrome P450.

· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - cytochrome P450.

· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - other enzymes.

· Metabolism > Global and overview maps > Metabolic pathways.

References

1). Targeting UGT2B15 and NR1H4 interaction: a novel therapeutic strategy for polycystic ovary syndrome using naftopidil enantiomers. Journal of ovarian research, 2025 (PubMed: 39856707) [IF=4.0]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.