MYL12A Antibody - #DF7798
| Product: | MYL12A Antibody |
| Catalog: | DF7798 |
| Description: | Rabbit polyclonal antibody to MYL12A |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 20 kDa; 20kD(Calculated). |
| Uniprot: | P19105 |
| RRID: | AB_2841253 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7798, RRID:AB_2841253.
Fold/Unfold
ML12A_HUMAN; MLC 2B; MLC-2B; MLCB; MYL12A; Myosin regulatory light chain 12A; Myosin regulatory light chain 2; Myosin regulatory light chain 2, nonsarcomeric; Myosin regulatory light chain MRCL3; Myosin regulatory light chain MRLC3; Myosin RLC; Myosin, light polypeptide, regulatory, non sarcomeric (20kD); nonsarcomeric; RLC;
Immunogens
A synthesized peptide derived from human MYL12A, corresponding to a region within C-terminal amino acids.
- P19105 ML12A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Research Backgrounds
Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion (By similarity).
Phosphorylation increases the actin-activated myosin ATPase activity and thereby regulates the contractile activity. It is required to generate the driving force in the migration of the cells but not necessary for localization of myosin-2 at the leading edge (By similarity).
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Focal adhesion. (View pathway)
· Cellular Processes > Cellular community - eukaryotes > Tight junction. (View pathway)
· Cellular Processes > Cell motility > Regulation of actin cytoskeleton. (View pathway)
· Organismal Systems > Immune system > Platelet activation. (View pathway)
· Organismal Systems > Immune system > Leukocyte transendothelial migration. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.