Thymidylate Synthase Antibody - #DF8096
Product: | Thymidylate Synthase Antibody |
Catalog: | DF8096 |
Description: | Rabbit polyclonal antibody to Thymidylate Synthase |
Application: | WB |
Reactivity: | Human, Monkey |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus |
Mol.Wt.: | 36 kDa; 36kD(Calculated). |
Uniprot: | P04818 |
RRID: | AB_2841443 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8096, RRID:AB_2841443.
Fold/Unfold
d TMP synthase; EC 2.1.1.45; HsT422; MGC88736; OTTHUMP00000162195; Thymidylate synthase; Thymidylate synthetase; TMS; TS; TSase; Tyms; TYMS protein; Tyms thymidylate synthetase; TYSY_HUMAN;
Immunogens
A synthesized peptide derived from human Thymidylate Synthase, corresponding to a region within the internal amino acids.
- P04818 TYSY_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Contributes to the de novo mitochondrial thymidylate biosynthesis pathway.
Nucleus. Cytoplasm. Mitochondrion. Mitochondrion matrix. Mitochondrion inner membrane.
Belongs to the thymidylate synthase family.
Research Fields
· Human Diseases > Drug resistance: Antineoplastic > Antifolate resistance.
· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.
· Metabolism > Metabolism of cofactors and vitamins > One carbon pool by folate.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.