MIP-1 alpha Antibody - #DF8572
| Product: | MIP-1 alpha Antibody |
| Catalog: | DF8572 |
| Description: | Rabbit polyclonal antibody to MIP-1 alpha |
| Application: | WB IHC |
| Cited expt.: | WB, IHC |
| Reactivity: | Human |
| Prediction: | Bovine, Horse |
| Mol.Wt.: | 10 kDa; 10kD(Calculated). |
| Uniprot: | P10147 |
| RRID: | AB_2841776 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8572, RRID:AB_2841776.
Fold/Unfold
C C motif chemokine 3; CCL 3; CCL3; CCL3_HUMAN; Chemokine C C motif ligand 3; G0/G1 switch regulatory protein 19 1; G0/G1 switch regulatory protein 19-1; G0S19 1; G0S19 1 protein; Heparin binding chemotaxis protein; L2G25B; LD78 alpha; LD78-alpha(4-69); LD78alpha; Macrophage inflammatory protein 1 alpha; Macrophage inflammatory protein 1-alpha; MIP 1 alpha; MIP 1A; MIP-1-alpha; MIP-1-alpha(4-69); MIP1A; PAT 464.1; SCYA 3; SCYA3; SIS alpha; SIS beta; SIS-beta; Small inducible cytokine A3; small inducible cytokine A3 (homologous to mouse Mip-1a); Small-inducible cytokine A3; Tonsillar lymphocyte LD78 alpha protein;
Immunogens
A synthesized peptide derived from human MIP-1 alpha, corresponding to a region within the internal amino acids.
- P10147 CCL3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).
N-terminal processed form LD78-alpha(4-69) is produced by proteolytic cleavage after secretion from HTLV1-transformed T-cells.
Secreted.
Belongs to the intercrine beta (chemokine CC) family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.
· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).
· Human Diseases > Immune diseases > Rheumatoid arthritis.
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
· Organismal Systems > Immune system > Toll-like receptor signaling pathway. (View pathway)
References
Application: IHC Species: human Sample:
Application: WB Species: human Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.