PGE synthase Antibody - #DF8592

Product: | PGE synthase Antibody |
Catalog: | DF8592 |
Description: | Rabbit polyclonal antibody to PGE synthase |
Application: | WB IHC |
Cited expt.: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 17 kDa; 17kD(Calculated). |
Uniprot: | O14684 |
RRID: | AB_2841796 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8592, RRID:AB_2841796.
Fold/Unfold
Glutathione S transferase 1 like 1; MGC10317; MGST IV; MGST1 L1; MGST1 like 1; MGST1-L1; MGST1L1; MGSTIV; Microsomal glutathione S transferase 1 like 1; Microsomal glutathione S-transferase 1-like 1; Microsomal prostaglandin E synthase 1; Microsomal prostaglandin E synthase 1; mPGES 1; MPGES; mPGES-1; p53 induced apoptosis protein 12; p53 induced gene 12; p53 induced gene 12 protein; p53-induced gene 12 protein; PGES; PIG 12; PIG12; PP 102; PP 1294; PP102; PP1294; Prostaglandin E synthase; PTGES; PTGES_HUMAN; TP53I12; Tumor protein p53 inducible protein 12;
Immunogens
A synthesized peptide derived from human PGE synthase, corresponding to a region within the internal amino acids.
- O14684 PTGES_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2).
Membrane>Multi-pass membrane protein.
Belongs to the MAPEG family.
Research Fields
· Metabolism > Lipid metabolism > Arachidonic acid metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
References
Application: WB Species: Mice Sample: endometriotic tissue
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.