Product: HSD3B1 Antibody
Catalog: DF9100
Description: Rabbit polyclonal antibody to HSD3B1
Application: WB IF/ICC
Reactivity: Human, Rat
Mol.Wt.: 42 kDa; 42kD(Calculated).
Uniprot: P14060
RRID: AB_2842296

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Rat
Clonality:
Polyclonal
Specificity:
HSD3B1 Antibody detects endogenous levels of total HSD3B1.
RRID:
AB_2842296
Cite Format: Affinity Biosciences Cat# DF9100, RRID:AB_2842296.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

3 beta HSD adrenal and gonadal type; 3 beta HSD II; 3 beta HSD type II; 3 beta hydroxy 5 ene steroid dehydrogenase; 3 beta hydroxy Delta(5) steroid dehydrogenase; 3 beta hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; 3 beta-hydroxysteroid dehydrogenase type II, delta 5-delta 4-isomerase type II, 3 beta-HSD type II; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; 3-beta-HSD II; 3-beta-hydroxy-5-ene steroid dehydrogenase; 3-beta-hydroxy-Delta(5)-steroid dehydrogenase; 3BHS2_HUMAN; ADRENAL HYPERPLASIA II; beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; delta 5 delta 4 isomerase type II; Delta-5-3-ketosteroid isomerase; HSD3B; HSD3B2; HSDB; HSDB3B; hydroxy delta 5 steroid dehydrogenase, 3 beta and steroid delta isomerase 2; Hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2; Progesterone reductase; SDR11E2; short chain dehydrogenase/reductase family 11E, member 2; Steroid Delta-isomerase;

Immunogens

Immunogen:

A synthesized peptide derived from human HSD3B1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P14060 3BHS1_HUMAN:

Placenta and skin (PubMed:1401999). Predominantly expressed in mammary gland tissue.

Sequence:
MTGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALQDPKKAPSIRGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWSFPLSLMYWIGFLLEIVSFLLRPIYTYRPPFNRHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ

Research Backgrounds

Function:

A bifunctional enzyme responsible for the oxidation and isomerization of 3beta-hydroxy-Delta(5)-steroid precursors to 3-oxo-Delta(4)-steroids, an essential step in steroid hormone biosynthesis. Specifically catalyzes the conversion of pregnenolone to progesterone, 17alpha-hydroxypregnenolone to 17alpha-hydroxyprogesterone, dehydroepiandrosterone (DHEA) to 4-androstenedione, and androstenediol to testosterone. Additionally, catalyzes the interconversion between 3beta-hydroxy and 3-oxo-5alpha-androstane steroids controlling the bioavalability of the active forms. Specifically converts dihydrotestosterone to its inactive form 5alpha-androstanediol, that does not bind androgen receptor/AR. Also converts androstanedione, a precursor of testosterone and estrone, to epiandrosterone. Expected to use NAD(+) as preferred electron donor for the 3beta-hydroxy-steroid dehydrogenase activity and NADPH for the 3-ketosteroid reductase activity (Probable).

Subcellular Location:

Endoplasmic reticulum membrane>Single-pass membrane protein. Mitochondrion membrane>Single-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Placenta and skin. Predominantly expressed in mammary gland tissue.

Family&Domains:

Belongs to the 3-beta-HSD family.

Research Fields

· Metabolism > Lipid metabolism > Steroid hormone biosynthesis.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Endocrine system > Ovarian steroidogenesis.

· Organismal Systems > Endocrine system > Aldosterone synthesis and secretion.

References

1). The co-expression of steroidogenic enzymes with T1R3 during testicular development in the Congjiang Xiang pig. Animal reproduction science, 2023 (PubMed: 37011421) [IF=2.2]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.