Product: KCNMB1 Antibody
Catalog: DF9301
Description: Rabbit polyclonal antibody to KCNMB1
Application: WB IHC IF/ICC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat, Monkey
Prediction: Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 22 kDa(Observed); 22kD(Calculated).
Uniprot: Q16558
RRID: AB_2842497

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat, Monkey
Prediction:
Bovine(90%), Horse(%), Sheep(%), Rabbit(%), Dog(%)
Clonality:
Polyclonal
Specificity:
KCNMB1 Antibody detects endogenous levels of total KCNMB1.
RRID:
AB_2842497
Cite Format: Affinity Biosciences Cat# DF9301, RRID:AB_2842497.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

BK channel beta subunit; BK channel subunit beta 1; BKbeta; BKbeta1; Calcium activated potassium channel subfamily M subunit beta 1; Calcium activated potassium channel subunit beta 1; Calcium activated potassium channel subunit beta; Charybdotoxin receptor subunit beta 1; Hbeta1; hslo beta; K(VCA)beta 1; K(VCA)beta; KCNMB 1; KCNMB1; Large conductance Ca2+ activated K+ channel beta 1 subunit; Maxi K channel beta subunit; Maxi K channel subunit beta 1; Potassium large conductance calcium activated channel subfamily M beta member 1; Slo beta 1; SLO beta;

Immunogens

Immunogen:

A synthesized peptide derived from human KCNMB1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q16558 KCMB1_HUMAN:

Abundantly expressed in smooth muscle. Low levels of expression in most other tissues. Within the brain, relatively high levels found in hippocampus and corpus callosum.

Sequence:
MVKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSVWTQESKCHLIETNIRDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQCSYIPGSVDNYQTARADVEKVRAKFQEQQVFYCFSAPRGNETSVLFQRLYGPQALLFSLFWPTFLLTGGLLIIAMVKSNQYLSILAAQK

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Bovine
90
Sheep
90
Dog
90
Rabbit
80
Pig
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Increases the apparent Ca(2+)/voltage sensitivity of the KCNMA1 channel. It also modifies KCNMA1 channel kinetics and alters its pharmacological properties. It slows down the activation and the deactivation kinetics of the channel. Acts as a negative regulator of smooth muscle contraction by enhancing the calcium sensitivity to KCNMA1. Its presence is also a requirement for internal binding of the KCNMA1 channel opener dehydrosoyasaponin I (DHS-1) triterpene glycoside and for external binding of the agonist hormone 17-beta-estradiol (E2). Increases the binding activity of charybdotoxin (CTX) toxin to KCNMA1 peptide blocker by increasing the CTX association rate and decreasing the dissociation rate.

PTMs:

N-glycosylated.

Subcellular Location:

Membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Abundantly expressed in smooth muscle. Low levels of expression in most other tissues. Within the brain, relatively high levels found in hippocampus and corpus callosum.

Family&Domains:

Belongs to the KCNMB (TC 8.A.14.1) family. KCNMB1 subfamily.

Research Fields

· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway.   (View pathway)

· Organismal Systems > Circulatory system > Vascular smooth muscle contraction.   (View pathway)

· Organismal Systems > Endocrine system > Insulin secretion.   (View pathway)

References

1). Thyrotropin induces atherosclerosis by upregulating large conductance Ca2+-activated K+ channel subunits. Molecular and cellular endocrinology, 2024 (PubMed: 38184154) [IF=3.8]

2). Fumaric acid and succinic acid treat gestational hypertension by downregulating the expression of KCNMB1 and TET1. Experimental and Therapeutic Medicine, 2021 (PubMed: 34447465) [IF=2.4]

Application: IHC    Species: Rat    Sample: placental cells

Figure 4 mRNA and protein levels of TET1 and KCNMB1 in the placenta of the control, model, DMF, succinic acid and DMF + succinic acid groups, which were examined by (A) immunohistochemical analysis, (B) reverse transcription-quantitative PCR and (C) western blotting. The protein of interest is brown in the immunohistochemical images. *P<0.05 vs. control; #P<0.05 vs. model. DMF, dimethyl fumarate; TET1, ten-eleven translocation 1; KCNMB1, calcium-activated potassium channel subunit β.

Application: WB    Species: Rat    Sample: placental cells

Figure 4 mRNA and protein levels of TET1 and KCNMB1 in the placenta of the control, model, DMF, succinic acid and DMF + succinic acid groups, which were examined by (A) immunohistochemical analysis, (B) reverse transcription-quantitative PCR and (C) western blotting. The protein of interest is brown in the immunohistochemical images. *P<0.05 vs. control; #P<0.05 vs. model. DMF, dimethyl fumarate; TET1, ten-eleven translocation 1; KCNMB1, calcium-activated potassium channel subunit β.

3). Effect of aortic smooth muscle BK channels on mediating chronic intermittent hypoxia-induced vascular dysfunction. The Korean journal of physiology & pharmacology : official journal of the Korean Physiological Society and the Korean Society of Pharmacology, 2024 (PubMed: 39198227) [IF=1.6]

Application: IHC    Species: Rat    Sample:

Fig. 1 Vascular dysfunction occurs, and BK channel activity is repressed in chronic intermittent hypoxia (CIH)-treated rats. (A) Systolic blood pressure (SBP) in the normoxia and CIH groups. (B) Diastolic blood pressure (DBP). (C) Mean blood pressure (MBP). (D) Vascular tone assessment. (E) H&E staining to detect pathological changes in rat aorta. (F) Immunohistochemistry to measure the expression of BK channels in rat aortic tissues. N = 6. The data were expressed as mean ± standard deviation. Data comparison between two groups was performed with the unpaired student’s t-test, and data comparison among multiple groups was conducted with a one-way analysis of variance, with Tukey’s for post-hoc test. IOD, integrated optical density; PE, phenylephrine; ACh, acetylcholine; SNP, sodium nitroprusside. *p < 0.05 compared with the normoxia group.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.