FOLR3 Antibody - #DF9519
| Product: | FOLR3 Antibody |
| Catalog: | DF9519 |
| Description: | Rabbit polyclonal antibody to FOLR3 |
| Application: | WB IHC |
| Cited expt.: | WB |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 25,37 kDa; 28kD(Calculated). |
| Uniprot: | P41439 |
| RRID: | AB_2842715 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9519, RRID:AB_2842715.
Fold/Unfold
Folate receptor 3 (gamma); Folate receptor 3; Folate receptor gamma; FOLR3; FOLR3_HUMAN; FR G; FR-gamma; Gamma hFR;
Immunogens
A synthesized peptide derived from human FOLR3, corresponding to a region within C-terminal amino acids.
- P41439 FOLR3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS
Research Backgrounds
Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. Isoform Short does not bind folate.
Secreted.
Spleen, thymus, bone marrow, ovarian carcinoma, and uterine carcinoma.
Belongs to the folate receptor family.
Research Fields
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
· Human Diseases > Drug resistance: Antineoplastic > Antifolate resistance.
References
Application: WB Species: Mouse Sample: Raw264.7 and MH7A cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.