SH3GL3 Antibody - #DF9907
Product: | SH3GL3 Antibody |
Catalog: | DF9907 |
Description: | Rabbit polyclonal antibody to SH3GL3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 39 kDa; 39kD(Calculated). |
Uniprot: | Q99963 |
RRID: | AB_2843101 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9907, RRID:AB_2843101.
Fold/Unfold
CNSA3; EEN 2B L3; EEN B2; EEN-B2; EEN2BL3; EENB2; Endophilin 3; Endophilin A3; Endophilin-3; Endophilin-A3; H.sapiens mRNA for protein containing SH3 domain, SH3GL3; HsT19371; SH3 domain containing GRB2 like protein 3; SH3 domain GRB2 like 3; SH3 domain protein 2C; SH3 domain-containing GRB2-like protein 3; SH3D2C; SH3G3_HUMAN; SH3GL3; SH3P13;
Immunogens
A synthesized peptide derived from human SH3GL3, corresponding to a region within the internal amino acids.
- Q99963 SH3G3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTGSNIPMDQPCCRGLYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Implicated in endocytosis. May recruit other proteins to membranes with high curvature (By similarity).
Cytoplasm. Early endosome membrane>Peripheral membrane protein.
Note: Associated with postsynaptic endosomes in hippocampal neurons. Associated with presynaptic endosomes in olfactory neurons.
Brain and testis.
An N-terminal amphipathic helix, the BAR domain and a second amphipathic helix inserted into helix 1 of the BAR domain (N-BAR domain) induce membrane curvature and bind curved membranes.
Belongs to the endophilin family.
Research Fields
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.