SFRS9 Antibody - #DF9948
| Product: | SFRS9 Antibody |
| Catalog: | DF9948 |
| Description: | Rabbit polyclonal antibody to SFRS9 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 26 kDa(Observed); 26kD(Calculated). |
| Uniprot: | Q13242 |
| RRID: | AB_2843142 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9948, RRID:AB_2843142.
Fold/Unfold
arginine/serine-rich 9; Pre mRNA splicing factor SRp30C; Pre-mRNA-splicing factor SRp30C; Serine/arginine-rich splicing factor 9; SFRS 9; Splicing factor; Splicing factor arginine/serine rich 9; splicing factor, arginine/serine-rich 9; splicing factor, arginine/serine-rich, 30-KD, C; SR splicing factor 9; SRP30C; SRSF9; SRSF9_HUMAN;
Immunogens
A synthesized peptide derived from human SFRS9, corresponding to a region within the internal amino acids.
Expressed at high levels in the heart, kidney, pancreas and placenta, and at lower levels in the brain, liver, lung and skeletal muscle.
- Q13242 SRSF9_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Plays a role in constitutive splicing and can modulate the selection of alternative splice sites. Represses the splicing of MAPT/Tau exon 10.
Extensively phosphorylated on serine residues in the RS domain.
Nucleus.
Note: Cellular stresses such as heat shock may induce localization to discrete nuclear bodies termed SAM68 nuclear bodies (SNBs), HAP bodies, or stress bodies. Numerous splicing factors including SRSF1/SFRS1/SF2, SRSF7/SFRS7, SAFB and KHDRBS1/SAM68 accumulate at these structures, which may participate in the post-transcriptional regulation of mRNAs in stressed cells.
Expressed at high levels in the heart, kidney, pancreas and placenta, and at lower levels in the brain, liver, lung and skeletal muscle.
Belongs to the splicing factor SR family.
Research Fields
· Genetic Information Processing > Transcription > Spliceosome.
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.