Product: MMP1 Antibody
Catalog: AF0209
Description: Rabbit polyclonal antibody to MMP1
Application: WB IF/ICC
Cited expt.: WB
Reactivity: Human
Prediction: Pig, Bovine, Horse, Sheep, Rabbit
Mol.Wt.: 54kDa; 54kD(Calculated).
Uniprot: P03956
RRID: AB_2833396

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Prediction:
Pig(88%), Bovine(88%), Horse(100%), Sheep(94%), Rabbit(100%)
Clonality:
Polyclonal
Specificity:
MMP1 Antibody detects endogenous levels of total MMP1.
RRID:
AB_2833396
Cite Format: Affinity Biosciences Cat# AF0209, RRID:AB_2833396.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

27 kDa interstitial collagenase; CLG; CLGN; collagenase, fibroblast; collagenase, interstitial; Fibroblast collagenase; Interstitial collagenase; Matrix metallopeptidase 1 (interstitial collagenase); Matrix metalloprotease 1; Matrix Metalloproteinase 1; Matrix metalloproteinase-1; MMP 1; MMP-1; MMP1; MMP1_HUMAN; OTTHUMP00000045866;

Immunogens

Immunogen:

A synthesized peptide derived from human MMP1, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Description:
MMP1 Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity. Belongs to the peptidase M10A family.
Sequence:
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Rabbit
100
Horse
100
Sheep
94
Pig
88
Bovine
88
Dog
69
Chicken
53
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity.

PTMs:

Undergoes autolytic cleavage to two major forms (22 kDa and 27 kDa). A minor form (25 kDa) is the glycosylated form of the 22 kDa form. The 27 kDa form has no activity while the 22/25 kDa form can act as activator for collagenase.

Tyrosine phosphorylated in platelets by PKDCC/VLK.

Subcellular Location:

Secreted>Extracellular space>Extracellular matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

There are two distinct domains in this protein; the catalytic N-terminal, and the C-terminal which is involved in substrate specificity and in binding TIMP (tissue inhibitor of metalloproteinases).

The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.

Belongs to the peptidase M10A family.

Research Fields

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Bladder cancer.   (View pathway)

· Human Diseases > Immune diseases > Rheumatoid arthritis.

· Organismal Systems > Endocrine system > PPAR signaling pathway.

· Organismal Systems > Immune system > IL-17 signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Relaxin signaling pathway.

References

1). Long-term simulated microgravity fosters carotid aging-like changes via Piezo1. Cardiovascular research, 2024 (PubMed: 38271270) [IF=10.2]

2). N6-methyladenosine Reader IGF2BP2-modified HMMR Promotes Non-small Cell Lung Cancer Metastasis via Interaction with MAP4K4. International journal of biological sciences, 2025 (PubMed: 39990663) [IF=8.2]

3). Brusatol Inhibits Proliferation and Invasion of Glioblastoma by Down-Regulating the Expression of ECM1. Frontiers in pharmacology, 2021 (PubMed: 34970146) [IF=5.6]

Application: WB    Species: Mouse    Sample:

FIGURE 6. The effect of ECM1 on invasion-related biomarkers. (A) Cells were transfected with siControl or siECM1 for 24–48 h and subjected to immunoblot analysis for measuring the expression of indicated proteins. (B) Cells were infected with pLV-vector (Control) or pLV-ECM1 (ECM1) for 24–48 h and then subjected to immunoblot analysis for measuring the expression of indicated proteins. (C) Immunoblot analyses showing ECM1, MMP2, TIMP2, MMP1, TIMP1 and MMP9 expression levels in xenograft tumors. The blots shown here were representatives of the average of five subcutaneously transplanted tumors in nude mice. (D) Representative images of IHC staining showed that Bru decreased the levels of ECM1 in subcutaneously transplanted xenograft tumors ().

4). Kanglexin, a new anthraquinone compound, attenuates hepatic fibrosis by regulating the TGF-β/SMADS signaling pathway and glutathione metabolism. International immunopharmacology, 2025 (PubMed: 40957167) [IF=4.8]

Application: WB    Species: Mouse    Sample:

Fig. 3. KLX inhibits activation of the TGF-β/SMADs pathway and ameliorates extracellular matrix deposition. (A) Effects of KLX on the expression of α-SMA, TGF-β, p-SMAD2, SMAD2, SMAD7 in liver tissue. (B) The IHC results of effects of KLX on the protein expression of collagen I and collagen III in mice (scale bar = 100 μm). (C) Effects of KLX on the expression of Desmin, Fibronectin, collagen I, and collagen III in liver tissue. (D) Effects of KLX on the expression of MMP-1, MMP-2, MMP-9 and TIMP-1 in liver tissue. A-D, n = 3. The data are presented as the mean ± SEM.

5). Parthenolide attenuated bleomycin-induced pulmonary fibrosis via the NF-κB/Snail signaling pathway. RESPIRATORY RESEARCH, 2018 (PubMed: 29871641) [IF=4.7]

Application: IHC    Species: human    Sample: lung

Fig. 6| PTL attenuates the BLM-induced expression of EMT-related protein. a Representative immunohistochemical staining of lung sections showing cadherin, vimentin, MMP1, α-SMA and Col-1 staining.

6). Identification of Active Compounds and Mechanism of Huangtu Decoction for the Treatment of Ulcerative Colitis by Network Pharmacology Combined with Experimental Verification. Drug Design Development and Therapy, 2021 (PubMed: 34616145) [IF=4.7]

Application: IHC    Species: Mice    Sample: colon tissues

Figure 9 Representative immunohistochemical staining with MMP1, MMP3, MMP7, MMP9 and MMP12 in colon tissues in mice treated with DSS. (A) Immunohistochemical staining for MMP1, MMP3, MMP7, MMP9 and MMP12 in normal, model and DSS+HTD group. (B) Statistical analysis of relative immunohistochemical staining intensity for MMP1, MMP3, MMP7, MMP9 and MMP12 in normal, model and DSS+HTD group.*P < 0.05, **P < 0.01 and ***P < 0.001 versus model group.

7). Timosaponin B-II alleviates osteoarthritis-related inflammation and extracellular matrix degradation through inhibition of mitogen-activated protein kinases and nuclear factor-κB pathways in vitro. Bioengineered, 2022 (PubMed: 35094658) [IF=4.2]

Application: WB    Species: Rat    Sample: SW1353 cells and chondrocytes

Figure 4. TB-II inhibited the production of cartilage degrading enzymes in IL-1β-treated SW1353 cells and chondrocytes. The mRNA expression of (a) MMP-1, (b) MMP-3 and (c) MMP-13 were detected by qRT-PCR. (d-g) The protein level of MMP-1, MMP-3, and MMP-13 were detected by Western blot. GAPDH was conducted as a loading control. One-way ANOVA, ##p < 0.01, compared with control cells; $p < 0.05, $$p < 0.01, ns: not-significant, compared with IL-1β-treated cells.

8). Milk-derived exosome-loaded SS31 as a novel strategy to mitigate UV-induced photodamage in skin. Journal of photochemistry and photobiology. B, Biology, 2025 (PubMed: 39970726) [IF=3.9]

9). Overexpression of SIRT6 regulates NRF2/HO-1 and NF-κB signaling pathways to alleviate UVA-induced photoaging in skin fibroblasts. Journal of photochemistry and photobiology. B, Biology, 2023 (PubMed: 37897855) [IF=3.9]

10). Ubiquitin-specific protease 49 attenuates IL-1β-induced rat primary chondrocyte apoptosis by facilitating Axin deubiquitination and subsequent Wnt/β-catenin signaling cascade inhibition. MOLECULAR AND CELLULAR BIOCHEMISTRY, 2020 (PubMed: 32737772) [IF=3.5]

Application: WB    Species: rat    Sample: chondrocytes

FIGURE 2 |e) Western blot analysis (right panel) and band intensity analysis (left panel) of the protein levels of Survivin, Mmp1, and Mmp13 in Control+Vehicle, Vector+IL-1β, and oeUSP49 +IL-1β rat chondro-cytes. ***P<0.001 versus the Vector or Control+Vehicle group; ## and ### indicate P values less than 0.01 and 0.001,respectively, versus the Vec-tor+IL-1β group

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.