NM23 Antibody - #AF0222
| Product: | NM23 Antibody |
| Catalog: | AF0222 |
| Description: | Rabbit polyclonal antibody to NM23 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Rabbit, Dog |
| Mol.Wt.: | 23kDa; 17kD(Calculated). |
| Uniprot: | P22392 |
| RRID: | AB_2833397 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0222, RRID:AB_2833397.
Fold/Unfold
C myc purine binding transcription factor PUF; C myc transcription factor; C-myc purine-binding transcription factor PUF; epididymis secretory sperm binding protein Li 155an; HEL-S-155an; Histidine protein kinase NDKB; MGC111212; MGC2212; NDK B; NDKB; NDKB_HUMAN; NDP kinase B; NDPK B; NDPKB; NM23 H2; nm23-H2; NM23B; NME/NM23 nucleoside diphosphate kinase 2; nme2; Non metastatic cells 2, protein (NM23B) expressed in; non-metastatic cells 2, protein (NM23) expressed in; Nucleoside diphosphate kinase B; Nucleotide diphosphate kinase B; PUF;
Immunogens
A synthesized peptide derived from human NM23, corresponding to a region within the internal amino acids.
- P22392 NDKB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity). Negatively regulates Rho activity by interacting with AKAP13/LBC. Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically. Binds to both single-stranded guanine- and cytosine-rich strands within the nuclease hypersensitive element (NHE) III(1) region of the MYC gene promoter. Does not bind to duplex NHE III(1). Has G-quadruplex (G4) DNA-binding activity, which is independent of its nucleotide-binding and kinase activity. Binds both folded and unfolded G4 with similar low nanomolar affinities. Stabilizes folded G4s regardless of whether they are prefolded or not. Exhibits histidine protein kinase activity.
Cytoplasm. Nucleus. Cell projection>Lamellipodium. Cell projection>Ruffle.
Note: Isoform 3 is mainly cytoplasmic and isoform 1 and isoform 3 are excluded from the nucleolus. Colocalizes with ITGB1 and ITGB1BP1 at the edge or peripheral ruffles and lamellipodia during the early stages of cell spreading on fibronectin or collagen but not on vitronectin or laminin substrates.
Isoform 1 and isoform 3 are ubiquitously expressed.
Belongs to the NDK family.
Research Fields
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.
· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - other enzymes.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.