Product: p15 INK4b Antibody
Catalog: AF0230
Description: Rabbit polyclonal antibody to p15 INK4b
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Bovine, Horse, Rabbit, Dog
Mol.Wt.: 14kDa; 15kD(Calculated).
Uniprot: P42772
RRID: AB_2833405

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC: 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Bovine(100%), Horse(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
p15 INK4b Antibody detects endogenous levels of total p15 INK4b.
RRID:
AB_2833405
Cite Format: Affinity Biosciences Cat# AF0230, RRID:AB_2833405.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CDK inhibitory protein; CDK4B Inhibitor; Cdkn2b; CDN2B_HUMAN; Cyclin dependent kinase 4 inhibitor B; Cyclin Dependent Kinase Inhibitor 2B; Cyclin dependent kinase inhibitor 2B p15 inhibits CDK4; Cyclin dependent kinases 4 and 6 binding protein; Cyclin-dependent kinase 4 inhibitor B; INK4B; MTS 2; MTS-2; MTS2; Multiple tumor suppressor 2; Multiple Tumor Supressor 2; OTTHUMP00000021154; OTTHUMP00000021155; p14 CDK inhibitor; p14 INK4b; p14-INK4b; P15; p15 CDK inhibitor; p15 inhibits CDK4; p15 INK4b; p15-INK4b; p15INK4B; TP 15; TP15;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P42772 CDN2B_HUMAN:

Isoform 2 is expressed in normal (keratinocytes, fibroblasts) and tumor cell lines.

Description:
p15-INK4B a potent inhibitor that nteracts strongly with CDK4 and CDK6. Potential effector of TGF-beta induced cell cycle arres
Sequence:
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Bovine
100
Dog
100
Rabbit
100
Chicken
75
Pig
0
Sheep
0
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P42772 As Substrate

Site PTM Type Enzyme
C74 S-Nitrosylation
R101 Methylation

Research Backgrounds

Function:

Interacts strongly with CDK4 and CDK6. Potent inhibitor. Potential effector of TGF-beta induced cell cycle arrest.

Subcellular Location:

Cytoplasm.
Note: Also found in the nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Isoform 2 is expressed in normal (keratinocytes, fibroblasts) and tumor cell lines.

Subunit Structure:

Heterodimer of CDKN2B with CDK4 or CDK6. Isoform 2 does not interact with CDK4 nor CDK6.

Family&Domains:

Belongs to the CDKN2 cyclin-dependent kinase inhibitor family.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

· Cellular Processes > Cell growth and death > Cellular senescence.   (View pathway)

· Environmental Information Processing > Signal transduction > FoxO signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

· Human Diseases > Cancers: Specific types > Small cell lung cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Gastric cancer.   (View pathway)

References

1). Sun L et al. Comprehensive Analysis of Cellular Senescence-Related Genes in Prognosis, Molecular Characterization and Immunotherapy of Hepatocellular Carcinoma. Biological Procedures Online 2022 Dec 19;24(24) (PubMed: 36536279) [IF=6.4]

2). Chen D et al. ANRIL inhibits p15(INK4b) through the TGFβ1 signaling pathway in human esophageal squamous cell carcinoma. CELLULAR IMMUNOLOGY 2014 May-Jun;289(1-2):91-6 (PubMed: 24747824) [IF=4.3]

Application: WB    Species:    Sample:


3). Liu et al. INK4 cyclin-dependent kinase inhibitors as potential prognostic biomarkers and therapeutic targets in hepatocellular carcinoma. Bioscience Reports 2022 Jun 30; (PubMed: 35771229) [IF=4.0]

4). Jiang Y et al. Overexpression of SMYD3 in Ovarian Cancer is Associated with Ovarian Cancer Proliferation and Apoptosis via Methylating H3K4 and H4K20. Journal of Cancer 2019 Jul 8;10(17):4072-4084 (PubMed: 31417652) [IF=3.9]

Application: WB    Species: human    Sample: HEY and A2780 cells

Figure 5. |SMYD3 regulated ovarian cancer proliferation and apoptosis though SMYD3-H4K20me3-CDKN2A and SMYD3-H3K4me3-BIRC3, respectively. (A-B) The protein expression changes in the above 6 genes in the HEY and A2780 cell lines after SMYD3 knockdown in HEY and A2780 cells.

5). Wang et al. Comprehensive Analysis of INK4 Cyclin-Dependent Kinase Inhibitors in Hepatocellular Carcinoma.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.