SUCLA2 Antibody - #DF12107
| Product: | SUCLA2 Antibody |
| Catalog: | DF12107 |
| Description: | Rabbit polyclonal antibody to SUCLA2 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus |
| Mol.Wt.: | 48-50 kDa(Observed); 50kD(Calculated). |
| Uniprot: | Q9P2R7 |
| RRID: | AB_2844912 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12107, RRID:AB_2844912.
Fold/Unfold
A BETA; A SCS; ATP specific succinyl CoA synthetase subunit beta; ATP specific succinyl CoA synthetase, beta subunit; ATP-specific succinyl-CoA synthetase subunit beta; Mitochondrial succinyl CoA ligase [ADP forming] subunit beta; MTDPS5; Renal carcinoma antigen NY-REN-39; Renal carcinoma antigen NYREN39; SCS betaA; SCS-betaA; SUCB1_HUMAN; Succinate CoA ligase (ADP forming); Succinate CoA ligase [ADP forming] subunit beta, mitochondrial; succinyl CoA ligase [ADP forming] subunit beta, mitochondrial; Succinate CoA ligase ADP forming beta subunit; Succinate CoA ligase beta subunit; Succinyl CoA ligase [ADP-forming] subunit beta, mitochondrial; Succinyl CoA synthetase beta A chain; Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial; Succinyl-CoA synthetase beta-A chain; SUCLA2;
Immunogens
A synthesized peptide derived from human SUCLA2, corresponding to a region within the internal amino acids.
- Q9P2R7 SUCB1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAASMFYGRLVAVATLRNHRPRTAQRAAAQVLGSSGLFNNHGLQVQQQQQRNLSLHEYMSMELLQEAGVSVPKGYVAKSPDEAYAIAKKLGSKDVVIKAQVLAGGRGKGTFESGLKGGVKIVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERKYPRREYYFAITMERSFQGPVLIGSSHGGVNIEDVAAESPEAIIKEPIDIEEGIKKEQALQLAQKMGFPPNIVESAAENMVKLYSLFLKYDATMIEINPMVEDSDGAVLCMDAKINFDSNSAYRQKKIFDLQDWTQEDERDKDAAKANLNYIGLDGNIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGATVHQVTEAFKLITSDKKVLAILVNIFGGIMRCDVIAQGIVMAVKDLEIKIPVVVRLQGTRVDDAKALIADSGLKILACDDLDEAARMVVKLSEIVTLAKQAHVDVKFQLPI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
ATP-specific succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA. The beta subunit provides nucleotide specificity of the enzyme and binds the substrate succinate, while the binding sites for coenzyme A and phosphate are found in the alpha subunit (By similarity).
Mitochondrion.
Widely expressed. Not expressed in liver and lung.
Belongs to the succinate/malate CoA ligase beta subunit family. ATP-specific subunit beta subfamily.
Research Fields
· Metabolism > Carbohydrate metabolism > Citrate cycle (TCA cycle).
· Metabolism > Carbohydrate metabolism > Propanoate metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Metabolism > Global and overview maps > Carbon metabolism.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.