Product: CHMP2A Antibody
Catalog: DF12147
Description: Rabbit polyclonal antibody to CHMP2A
Application: WB IHC IF/ICC
Cited expt.: IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus
Mol.Wt.: 32 kDa(Observed); 25kD(Calculated).
Uniprot: O43633
RRID: AB_2844952

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Zebrafish(92%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
CHMP2A Antibody detects endogenous levels of total CHMP2A.
RRID:
AB_2844952
Cite Format: Affinity Biosciences Cat# DF12147, RRID:AB_2844952.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

BC 2; BC2; Charged multivesicular body protein 2a; CHM2A_HUMAN; CHMP2; CHMP2a; Chromatin modifying protein 2a; Chromatin-modifying protein 2a; hVps2 1; hVps2-1; putative breast adenocarcinoma marker; Putative breast adenocarcinoma marker BC-2; Putative breast adenocarcinoma marker BC2; Vacuolar protein sorting associated protein 2 1; Vacuolar protein sorting-associated protein 2-1; Vps2 1; VPS2; Vps2-1; VPS2A;

Immunogens

Immunogen:

A synthesized peptide derived from human CHMP2A, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Sequence:
MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Rabbit
100
Zebrafish
92
Chicken
64
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis. Together with SPAST, the ESCRT-III complex promotes nuclear envelope sealing and mitotic spindle disassembly during late anaphase. ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4.

(Microbial infection) The ESCRT machinery functions in topologically equivalent membrane fission events, such as the budding of enveloped viruses (HIV-1 and other lentiviruses). Involved in HIV-1 p6- and p9-dependent virus release.

PTMs:

ISGylated in a CHMP5-dependent manner. Isgylation weakens and inhibits its interactions with VPS4A and VTA1 respectively.

Subcellular Location:

Late endosome membrane>Peripheral membrane protein>Cytoplasmic side.
Note: Localizes to the midbody of dividing cells. Localized in two distinct rings on either side of the Fleming body.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

The acidic C-terminus and the basic N-termminus are thought to render the protein in a closed, soluble and inactive conformation through an autoinhibitory intramolecular interaction. The open and active conformation, which enables membrane binding and oligomerization, is achieved by interaction with other cellular binding partners, probably including other ESCRT components.

Belongs to the SNF7 family.

Research Fields

· Cellular Processes > Transport and catabolism > Endocytosis.   (View pathway)

· Cellular Processes > Cell growth and death > Necroptosis.   (View pathway)

References

1). Cancer Cells Enter an Adaptive Persistence to Survive Radiotherapy and Repopulate Tumor. Advanced science (Weinheim, Baden-Wurttemberg, Germany), 2023 (PubMed: 36658726) [IF=15.1]

Application: IF/ICC    Species: Mouse    Sample: RTP cells

Figure 3 Poly-aneuploid RTP cells produced proliferating progenies via a viral budding-like cell division. A) Time-lapse sequences illustrating budding of an HCT116-RTP cell expressing H2B-EGFP following 8 Gy. A daughter cell (pink triangle) is being budded off. Scale bars, 25 µm. B) Representative iFISH images of HCT116 cultivated in suspension illustrating the alteration of ploidy number at indicated time points following 10 Gy. Ploidy number was visualized by CEP8 probe (human chromosome 8), DNA and cytokeratin was stained by DAPI (blue) and CK18 (golden). Scale bars, 25 µm. C) Copy numbers of chromosome 8 (CEP8, red) and centrosome (γ-tubulin, green) were detected by iFISH in unirradiated and 8Gy-treated HCT116. (Middle): A RTP cell (yellow triangle) in process of budding is surrounded by diploid progeny cells (white triangle), which is centrosome (red triangle) independent. (Right): A repopulated tumor cell is undergoing mitosis. D) Immunofluorescent staining of budding RTP cells by EdU (red), DAPI (blue) and senescence-associated β-gal (green). E) Schematic of the naming principle and cell count of cells samples collected for SMART RNA-seq. Single cells from untreated HCT116 (both p53+/+ and p53−/−) cells were defined as [N], while cells derived from pre-budding RTP cells, budding RTP cells, budded and repopulated small cells were, respectively, defined as [P], [B], [S], and [R]. F) Gene set enrichment analysis (GSEA) showing positive enrichment for budding and maturation of human immunodeficiency virus (HIV) virion in budding RTP cells relative to pre-budding RTP cells. G) Expression of ESCRT genes CHMP2A and VPS28 in violin plots and in immunofluorescent staining. Scale bar, 25 mm. iFISH: immunofluorescence in situ hybridization; ESCRT: endosomal sorting complex required for transport.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.