| Product: | CKMT1A Antibody |
| Catalog: | DF12257 |
| Description: | Rabbit polyclonal antibody to CKMT1A |
| Application: | WB IHC IF/ICC |
| Cited expt.: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Chicken |
| Mol.Wt.: | 45 kDa(Observed); 47kD(Calculated). |
| Uniprot: | P12532 |
| RRID: | AB_2845062 |
Control Products
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12257, RRID:AB_2845062.
Fold/Unfold
Acidic-type mitochondrial creatine kinase; CKMT; CKMT1; CKMT1B; Creatine kinase mitochondrial 1 (ubiquitous); Creatine kinase mitochondrial 1B; Creatine kinase U type mitochondrial; Creatine kinase U-type; KCRU_HUMAN; Mia-CK; mitochondrial; U-MtCK; Ubiquitous mitochondrial creatine kinase; UMTCK;
Immunogens
A synthesized peptide derived from human CKMT1A, corresponding to a region within N-terminal amino acids.
- P12532 KCRU_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.
Mitochondrion inner membrane>Peripheral membrane protein>Intermembrane side.
Belongs to the ATP:guanido phosphotransferase family.
Research Fields
· Metabolism > Amino acid metabolism > Arginine and proline metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
References
Application: WB Species: Mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.