COQ7 Antibody - #DF12259
| Product: | COQ7 Antibody |
| Catalog: | DF12259 |
| Description: | Rabbit polyclonal antibody to COQ7 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 22 kDa; 24kD(Calculated). |
| Uniprot: | Q99807 |
| RRID: | AB_2845064 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12259, RRID:AB_2845064.
Fold/Unfold
5 demethoxyubiquinone hydroxylase mitochondrial; CAT5; CLK 1; CLK1; Coenzyme Q biosynthesis protein 7 homolog; Coenzyme Q7 homolog ubiquinone; Coenzyme Q7 hydroxylase; COQ10D8; coq7; COQ7 coenzyme Q 7 homolog ubiquinone; COQ7 protein; COQ7_HUMAN; DMQ hydroxylase; Placental protein KG 20; Timing protein clk-1 homolog; Ubiquinone biosynthesis monooxygenase COQ7; Ubiquinone biosynthesis protein COQ7 homolog;
Immunogens
A synthesized peptide derived from human COQ7, corresponding to a region within the internal amino acids.
- Q99807 COQ7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Catalyzes the hydroxylation of 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2) during ubiquinone biosynthesis. Has also a structural role in the COQ enzyme complex, stabilizing other COQ polypeptides. Involved in lifespan determination in a ubiquinone-independent manner.
Mitochondrion inner membrane>Peripheral membrane protein>Matrix side.
Expressed dominantly in heart and skeletal muscle.
Belongs to the COQ7 family.
Research Fields
· Metabolism > Metabolism of cofactors and vitamins > Ubiquinone and other terpenoid-quinone biosynthesis.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.