Phospho-p40 phox (Thr154) Antibody - #AF2376
| Product: | Phospho-p40 phox (Thr154) Antibody |
| Catalog: | AF2376 |
| Description: | Rabbit polyclonal antibody to Phospho-p40 phox (Thr154) |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Zebrafish, Horse, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 40kDa; 39kD(Calculated). |
| Uniprot: | Q15080 |
| RRID: | AB_2845390 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF2376, RRID:AB_2845390.
Fold/Unfold
CGD3; MGC3810; NCF 4; NCF; NCF-4; Ncf4; NCF4_HUMAN; Neutrophil cytosol factor 4; Neutrophil cytosolic factor 4; Neutrophil NADPH oxidase factor 4; p40-phox; p40phox; SH3 and PX domain-containing protein 4; SH3PXD4;
Immunogens
A synthesized peptide derived from human p40 phox around the phosphorylation site of Thr154.
- Q15080 NCF4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Component of the NADPH-oxidase, a multicomponent enzyme system responsible for the oxidative burst in which electrons are transported from NADPH to molecular oxygen, generating reactive oxidant intermediates. It may be important for the assembly and/or activation of the NADPH-oxidase complex.
Cytoplasm>Cytosol. Endosome membrane>Peripheral membrane protein>Cytoplasmic side. Membrane>Peripheral membrane protein.
Expression is restricted to hematopoietic cells.
The PB1 domain mediates the association with NCF2/p67-PHOX.
The PX domain mediates interaction with membranes enriched in phosphatidylnositol 3-phosphate.
Research Fields
· Cellular Processes > Transport and catabolism > Phagosome. (View pathway)
· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.
· Organismal Systems > Development > Osteoclast differentiation. (View pathway)
· Organismal Systems > Immune system > Leukocyte transendothelial migration. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.