Product: Cleaved-Caspase 1 (Ala317), p10 Antibody
Catalog: AF4022
Description: Rabbit polyclonal antibody to Cleaved-Caspase 1 (Ala317), p10
Application: WB IHC IF/ICC
Cited expt.: WB, IHC, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Rabbit, Dog
Mol.Wt.: 10kD,45kD; 45kD(Calculated).
Uniprot: P29466
RRID: AB_2845464

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(88%), Rabbit(100%), Dog(88%)
Clonality:
Polyclonal
Specificity:
Cleaved-Caspase-1 (Ala317,p10) Antibody detects endogenous levels of fragment of activated Caspase-1 resulting from cleavage adjacent to Ala317.
RRID:
AB_2845464
Cite Format: Affinity Biosciences Cat# AF4022, RRID:AB_2845464.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CASP-1; CASP1; CASP1_HUMAN; Caspase 1; Caspase-1 subunit p10; ICE; IL-1 beta-converting enzyme; IL-1BC; IL1 beta converting enzyme; IL1B convertase; Interleukin 1 beta convertase; Interleukin 1B converting enzyme; Interleukin-1 beta convertase; Interleukin-1 beta-converting enzyme; p45;

Immunogens

Immunogen:

The antiserum was produced against synthesized peptide derived from human Caspase 1.

Uniprot:
Gene(ID):
Expression:
P29466 CASP1_HUMAN:

Expressed in larger amounts in spleen and lung. Detected in liver, heart, small intestine, colon, thymus, prostate, skeletal muscle, peripheral blood leukocytes, kidney and testis. No expression in the brain.

Sequence:
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
100
Rabbit
100
Horse
88
Dog
88
Sheep
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Can also promote apoptosis. Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive. In apoptotic cells, cleaves SPHK2 which is released from cells and remains enzymatically active extracellularly.

PTMs:

The two subunits are derived from the precursor sequence by an autocatalytic mechanism.

Subcellular Location:

Cytoplasm. Cell membrane.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in larger amounts in spleen and lung. Detected in liver, heart, small intestine, colon, thymus, prostate, skeletal muscle, peripheral blood leukocytes, kidney and testis. No expression in the brain.

Family&Domains:

Belongs to the peptidase C14A family.

Research Fields

· Cellular Processes > Cell growth and death > Necroptosis.   (View pathway)

· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).

· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.

· Human Diseases > Infectious diseases: Bacterial > Pertussis.

· Human Diseases > Infectious diseases: Bacterial > Legionellosis.

· Human Diseases > Infectious diseases: Viral > Influenza A.

· Organismal Systems > Immune system > NOD-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Cytosolic DNA-sensing pathway.   (View pathway)

References

1). An artificial metabzyme for tumour-cell-specific metabolic therapy. Nature nanotechnology, 2024 (PubMed: 39103450) [IF=38.1]

2). p66Shc Contributes to Liver Fibrosis through the Regulation of Mitochondrial Reactive Oxygen Species. Theranostics, 2019 (PubMed: 30867846) [IF=12.4]

Application: WB    Species: mouse    Sample: Liver

Figure 2.| p66Shc silencing attenuates liver fibrosis in mice. p66Shc silencing was induced via lentivirus delivered to C57BL/6 mice exposed to CCl4 (2 ml/kg). (A) Liver p66Shc mRNA expression, n=6. (B) Liver p66Shc, SOD2, UCP1, Col1a1, α-SMA protein, n=3. (C) H2O2 content, n=8. (D) SOD activity, n=8. (E) Cytochrome c expression in the cytoplasm and mitochondria, n=3. (F) H&E and Masson staining. Scale bar, 200 μm. (G) Ishak score of Masson staining. (H) Serum ALT and AST levels, n=8. (I) Liver NLRP3 inflammasome protein expression, n=3.

3). Water-extracted Lonicera japonica polysaccharide attenuates allergic rhinitis by regulating NLRP3-IL-17 signaling axis. Carbohydrate Polymers, 2022 (PubMed: 36184153) [IF=10.7]

4). AIM2 Inflammasome Mediates Hallmark Neuropathological Alterations and Cognitive Impairment in a Mouse Model of Vascular Dementia. Molecular Psychiatry, 2020 (PubMed: 33299135) [IF=9.6]

5). NLRP3-GABA signaling pathway contributes to the pathogenesis of impulsive-like behaviors and cognitive deficits in aged mice. Journal of neuroinflammation, 2023 (PubMed: 37434240) [IF=9.3]

Application: IF/ICC    Species: Mouse    Sample: hippocampus

Fig. 6 Cognitive impairment may be related to pyroptosis-associated inflammatory responses in astrocytes. A Representative photomicrographs of NLRP3-, IL-18-, IL-1β- and cleaved caspase-1-positive cells in the CA1 of the hippocampus at 12 h and 10 days after surgical exposure. Scale bar = 50 μm. B Image of CA1 in hippocampus. C–J Co-stained area of NLRP3-, IL-18-, IL-1β-, cleaved caspase-1- and GFAP-positive cells in the CA1 of the hippocampus. K Representative western blot of NLRP3, IL-1β, IL-18 and cleaved caspase-1 at 12 h after surgical exposure. L–O The optical density values of NLRP3, IL-1β, IL-18, and cleaved caspase-1 at 12 h after surgical exposure. P Representative western blot of NLRP3, IL-1β, IL-18 and cleaved caspase-1 at 10 days after surgical exposure. Q–T The optical density values of NLRP3, IL-1β, IL-18 and cleaved caspase-1 at 10 days after surgical exposure. Data are presented as the mean ± SD (n = 6 mice/group or n = 3 mice/group). Data were analyzed by one-way ANOVA with Tukey’s multiple comparison test or Kruskal–Wallis and Dunn’s multiple comparison test. ***P 

6). Mesenchymal stem cells protect against TBI-induced pyroptosis in vivo and in vitro through TSG-6. Cell Communication and Signaling, 2022 (PubMed: 35982465) [IF=8.4]

7). Physicochemical characterization of polysaccharide from the leaf of Dendrobium officinale and effect on LPS induced damage in GES-1 cell. International Journal of Biological Macromolecules, 2020 (PubMed: 31945440) [IF=7.7]

Application: WB    Species: Human    Sample: GES-1 cells

Fig. 9. LDOP-1 protects LPS-induced GES-1 damage through inhibiting the TLR4/NF-kb signaling pathway. (A) The protein expressions of cleaved-IL-1β, IL-6, pro-caspase 1 Caspase 1, NF- κB, phospho-NF-κB, TLR4, NLRP3, ASC, phospho-IκBα and IκBα, (B–D) Expression levels of Cleaved-IL-1β, IL-6 and ASC protein were analyzed. (E–G) Protein expression levels ratio of cleaved-caspase-1 to pro-caspase-1, phospho-IκBα to IκBα and, phospho-NF-кB to NF-κB. (H–I) Expression levels of NLRP3 and TLR4 protein were analyzed. The location assay of by laser scanning confocal microscopy. β-Actin was used as control. (J) Expression of IL-6 were observed by fluorescence microscopy, red indicated positive immunofluorescence results for IL-6, blue indicated the result of DAPI. The data were presented as the mean ± SD from three independent experiments (n = 3). Compared to the control group, #p b 0.05, ##p b 0.01; compared to the model group *p b 0.05, **p b 0.01.

8). Epimedium Aqueous Extract Ameliorates Cerebral Ischemia/Reperfusion Injury through Inhibiting ROS/NLRP3-Mediated Pyroptosis. Antioxidants, 2023 (PubMed: 37237865) [IF=7.0]

9). Disulfiram alleviates pristane-induced lupus via inhibiting GSDMD-mediated pyroptosis. Cell Death Discovery, 2022 (PubMed: 36057687) [IF=7.0]

Application: IF/ICC    Species: Human    Sample: THP-1 cells

Fig. 2 GSDMD-mediated pyroptosis of THP-1 cells induced by serum from SLE patients was suppressed by DSF. A Effect of DSF on the cell viability of THP-1 cells. Cells were treated with DSF (0, 1, 5, 10, 20 μM) for 48 h and then cell viability measured by CCK-8 assay. B The morphological features of THP-1 cells treated with serums from healthy controls or SLE patients, with or without mixing 10 μM disulfiram. C Lactate dehydrogenase (LDH) release from THP-1 cells treated as indicated. D Hoechst33342/Propidium Iodide (PI) double staining in THP-1 cells after different treatments. E Representative immunofluorescence images showing the expression of NLRP3, caspase-1, and cleaved caspase-1 in THP-1 cells treated as indicated. F The expression of full length and cleaved GSDMD in THP-1 cells. The cells were incubated in different mediums and analyzed by western blot analysis. β-actin was used as a protein loading control. G, H The expression level of total GSDMD and cleaved-GSDMD relative to β-actin were quantified. Total GSDMD = full length-GSDMD + cleaved-GSDMD. Significant differences were calculated using one-way ANOVA. Values were shown as mean ± SD. *p < 0.05, **p < 0.01, ***p < 0.001. Each experiment was repeated three times. FBS fetal bovine serum, HC Healthy control, NS not significant, PI propidium iodide, LDH Lactate dehydrogenase.

10). The Chinese herbal medicine Fufang Zhenzhu Tiaozhi protects against diabetic cardiomyopathy by alleviating cardiac lipotoxicity-induced oxidative stress and NLRP3-dependent inflammasome activation. BIOMEDICINE & PHARMACOTHERAPY, 2022 (PubMed: 35190353) [IF=6.9]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.