Product: TREM2 Antibody
Catalog: DF12529
Description: Rabbit polyclonal antibody to TREM2
Application: WB IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse
Mol.Wt.: 25 kDa, 29 kDa(Observed); 25kD(Calculated).
Uniprot: Q9NZC2
RRID: AB_2845491

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
TREM2 Antibody detects endogenous levels of total TREM2.
RRID:
AB_2845491
Cite Format: Affinity Biosciences Cat# DF12529, RRID:AB_2845491.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

TREM 2; TREM-2; TREM2; TREM2_HUMAN; TREM2a; TREM2b; TREM2c; Trggering receptor expressed on myeloid cells 2; Trggering receptor expressed on myeloid cells 2a; Triggering receptor expressed on monocytes 2; Triggering receptor expressed on myeloid cells 2;

Immunogens

Immunogen:

A synthesized peptide derived from human TREM2, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
Q9NZC2 TREM2_HUMAN:

Expressed in the brain, specifically in microglia and in the fusiform gyrus (at protein level) (PubMed:28802038, PubMed:28855300, PubMed:27477018, PubMed:29752066). Expressed on macrophages and dendritic cells but not on granulocytes or monocytes (PubMed:10799849, PubMed:28855301). In the CNS strongest expression seen in the basal ganglia, corpus callosum, medulla oblongata and spinal cord (PubMed:12080485).

Sequence:
MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT

Research Backgrounds

Function:

Forms a receptor signaling complex with TYROBP which mediates signaling and cell activation following ligand binding. Acts as a receptor for amyloid-beta protein 42, a cleavage product of the amyloid-beta precursor protein APP, and mediates its uptake and degradation by microglia. Binding to amyloid-beta 42 mediates microglial activation, proliferation, migration, apoptosis and expression of pro-inflammatory cytokines, such as IL6R and CCL3, and the anti-inflammatory cytokine ARG1 (By similarity). Acts as a receptor for lipoprotein particles such as LDL, VLDL, and HDL and for apolipoproteins such as APOA1, APOA2, APOB, APOE, APOE2, APOE3, APOE4, and CLU and enhances their uptake in microglia. Binds phospholipids (preferably anionic lipids) such as phosphatidylserine, phosphatidylethanolamine, phosphatidylglycerol and sphingomyelin. Regulates microglial proliferation by acting as an upstream regulator of the Wnt/beta-catenin signaling cascade (By similarity). Required for microglial phagocytosis of apoptotic neurons. Also required for microglial activation and phagocytosis of myelin debris after neuronal injury and of neuronal synapses during synapse elimination in the developing brain (By similarity). Regulates microglial chemotaxis and process outgrowth, and also the microglial response to oxidative stress and lipopolysaccharide (By similarity). It suppresses PI3K and NF-kappa-B signaling in response to lipopolysaccharide; thus promoting phagocytosis, suppressing pro-inflammatory cytokine and nitric oxide production, inhibiting apoptosis and increasing expression of IL10 and TGFB (By similarity). During oxidative stress, it promotes anti-apoptotic NF-kappa-B signaling and ERK signaling (By similarity). Plays a role in microglial MTOR activation and metabolism (By similarity). Regulates age-related changes in microglial numbers. Triggers activation of the immune responses in macrophages and dendritic cells. Mediates cytokine-induced formation of multinucleated giant cells which are formed by the fusion of macrophages (By similarity). In dendritic cells, it mediates up-regulation of chemokine receptor CCR7 and dendritic cell maturation and survival. Involved in the positive regulation of osteoclast differentiation.

PTMs:

Undergoes ectodomain shedding through proteolytic cleavage by ADAM10 and ADAM17 to produce a transmembrane segment, the TREM2 C-terminal fragment (TREM2-CTF), which is subsequently cleaved by gamma-secretase.

Subcellular Location:

Cell membrane>Single-pass type I membrane protein.

Secreted.

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in the brain, specifically in microglia and in the fusiform gyrus (at protein level). Expressed on macrophages and dendritic cells but not on granulocytes or monocytes. In the CNS strongest expression seen in the basal ganglia, corpus callosum, medulla oblongata and spinal cord.

Research Fields

· Organismal Systems > Development > Osteoclast differentiation.   (View pathway)

References

1). Synergistic Modulation of Microglial Polarization by Acteoside and Ferulic Acid via Dual Targeting of Nrf2 and RORγt to Alleviate Depression-Associated Neuroinflammation. Advanced science (Weinheim, Baden-Wurttemberg, Germany), 2025 (PubMed: 40832701) [IF=15.1]

Application: WB    Species: Mouse    Sample:

Figure 5 ACT combined with FA modulates microglial polarization via Nrf2 activation and RORγt/IL-17AR Signaling. A) Expression of M1 (iNOS) and M2 (Arg-1) microglial polarization markers in the prefrontal cortex. B) Quantitative analysis of Nrf2, TREM2, DAP12, RORγt, and IL-17AR mRNA expression in the mPFC. C) Western blot of Nrf2/TREM2/DAP12/Arg-1 and RORγt/IL-17AR protein levels; GAPDH served as the internal control. D–I) Cytokine and neurotransmitter levels: IL-1β (D), IL-6 (E), IL-17A (F), IL-10 (G), GABA (H), and Glu (I). Data are presented as the mean ± SEM (n=6 per/group). ** p

2). Tanshinone IIA-pretreated mesenchymal stem cells alleviate neuroinflammation in 3×Tg-AD mice via the TREM2/PI3K/Akt pathway. Stem cell research & therapy, 2026 (PubMed: 41845487) [IF=7.5]

3). TREM2 deficiency exacerbates cognitive impairment by aggravating α-Synuclein-induced lysosomal dysfunction in Parkinson's disease. Cell death discovery, 2025 (PubMed: 40393958) [IF=7.0]

Application: IF/ICC    Species: Mouse    Sample:

Fig. 1: TREM2 deficiency impaired cognitive function in PD mice. A Representative image of TREM2 (red) and IBA1 (green) immunofluorescence staining in hippocampal tissue sections of the PD and control specimens. Scale bar, 50μm. B Representative image of TREM2 (red) and IBA1 (green) immunofluorescence staining in hippocampus in C57BL/6 mice and A53T mice. Scale bar, 50 μm. C Quantification of number of TREM2+ IBA1+ cells in PD specimens and control specimens (n = 3, unpaired Student’s t test) and TREM2+ IBA1+ cells in C57BL/6 mice and A53T mice (n = 3, unpaired Student’s t test). D Recognition Index was calculated in NORT (n = 9, one-way ANOVA and Šídák’s multiple comparisons test). E Representative image showing the procedure and swimming paths obtained from each group in the acquisition phase in MWM. F Time spent in the target quadrant (s) in the acquisition phase in MWM (n = 9, one-way ANOVA and Šídák’s multiple comparisons test). G Representative image showing the paths obtained from each group in the acquisition phase in Open field test. Line chart showing the average escape latencies in each group in the space exploring phase in MWM (n = 9, two-way ANOVA and Tukey’s multiple comparisons test). Column charts showing. The error bars represent the ± SDs. **p 

Application: WB    Species: Mouse    Sample:

Fig. 5: Knockdown of TREM2 aggravated α-Syn-induced lysosomal dysfunction in BV-2 cells via the ERK1/2/TFEB pathway. A Representative images of western blotting analysis of TREM2, ERK1/2, and p-ERK1/2 expressions in TREM2KD BV-2 cells and NCKD BV-2 cells. B Representative images of western blotting analysis of Total-TFEB, Nuclear-TFEB, and Cytoplasm-TFEB expressions in TREM2KD BV-2 cells and NCKD BV-2 cells. C Quantification of TREM2, ERK1/2, p-ERK1/2, Total-TFEB, Nuclear-TFEB, and Cytoplasm-TFEB expressions proteins relative expression (n = 3, one-way ANOVA and Šídák’s multiple comparisons test). D Representative images of TFEB (red) immunofluorescence staining in TREM2KD BV-2 cells and NCKD BV-2 cells. Scale bar, 10 μm. E Quantification of Nuclear- Cytoplasm TFEB Fluorescence ratio in TREM2KD BV-2 cells and NCKD BV-2 cells (n = 3, one-way ANOVA and Šídák’s multiple comparisons test). F Representative images of DQ-BSA (red), Lysotracker (red), and CathB (red) in TREM2KD BV-2 cells and NCKD BV-2 cells. Scale bar, 10μm. G Representative images of α-Syn (red) and Lamp1 (green) immunofluorescence staining in TREM2KD BV-2 cells and NCKD BV-2 cells. Scale bar, 5 μm. H Quantification of integrated density of DQ-BSA, Lysotracker, and CathB in TREM2KD BV-2 cells and NCKD BV-2 cells (n = 3, one-way ANOVA and Šídák’s multiple comparisons test). I Quantification of MCC of α-Syn and Lamp1 in TREM2KD BV-2 cells and NCKD BV-2 cells (n = 3, unpaired Student’s t test) and mean Fluorescence intensity of α-Syn in TREM2KD BV-2 cells and NCKD BV-2 cells (n = 3, unpaired Student’s t test). The error bars represent ± SDs. *p 

4). PFKFB3 decreases α-ketoglutarate production while partial PFKFB3 knockdown in macrophages ameliorates arthritis in tumor necrosis factor-transgenic mice. International immunopharmacology, 2025 (PubMed: 39870011) [IF=4.8]

5). Buyang Huanwu decoction promotes post-stroke white matter repair via TREM2-Dependent microglial phagocytosis and IGF1 secretion. Journal of ethnopharmacology, 2026 (PubMed: 40912481) [IF=4.8]

6). Long-Term Administration of Triterpenoids From Ganoderma lucidum Mitigates Age-Associated Brain Physiological Decline via Regulating Sphingolipid Metabolism and Enhancing Autophagy in Mice. Frontiers in Aging Neuroscience, 2021 (PubMed: 34025387) [IF=4.1]

Application: WB    Species: mouse    Sample: brain

FIGURE 9 | Ameliorate effects of Ganodenic acid A by regulating sphingolipid metabolism in 3 × Tg-AD mice. (A) Experimental procedure in 3 × Tg-AD mice;(B) The AD biomarkers of p-Tau, Aβ, APOE, TREM2, CD33, the inflammatory cytokines of TNF-α and NF-κB p65 and the autophagy level of LC3A/B were measured in brain tissues

7). Tanshinone ΙΙA-Incubated Mesenchymal Stem Cells Inhibit Lipopolysaccharide-Induced Inflammation of N9 Cells through TREM2 Signaling Pathway. Stem Cells International, 2022 (PubMed: 35283996) [IF=3.8]

Application: WB    Species: Mice    Sample: MSC

Figure 2 RT-qPCR and Western blotting analyses of TREM2 siRNA transfection efficiency. (a) Relative expression levels of TREM2 mRNA. (b) Expression levels of TREM2 protein. aP < 0.05 vs. control, bP < 0.05 vs. siRNA-NC, mean ± SEM, n = 3.

Application: WB    Species: mouse    Sample:

Figure 2:| RT-qPCR and Western blotting analyses of TREM2 siRNA transfection efficiency. (a) Relative expression levels of TREM2 mRNA. (b) Expression levels of TREM2 protein.

8). Schistosoma japonicum cystatin suppresses osteoclastogenesis via manipulating the NF‑κB signaling pathway. Molecular Medicine Reports, 2021 (PubMed: 33576450) [IF=3.4]

Application: WB    Species:    Sample: RAW264.7 cells

Figure 4. |rSj‑Cys inhibits the expression of osteoclastogenesis‑related genes and proteins. RAW264.7 cells were co‑stimulated with M‑CSF (25 ng/ml) and RANKL (30 ng/ml) and then treated with or without rSj‑Cys (0.3 µM) for different time periods (24, 48 or 72 h). The expression levels of genes and proteins associated with osteoclast phenotype markers (CTSK, TRAP, ITGB3) and cell surface receptors of osteoclast precursors (RANK, OSCAR, TREM‑2)were determined by (A) reverse transcription‑quantitative PCR and (B) western blot analysis.

9). Tetrahydroxy Stilbene Glycoside Reduces Abeta Deposition by Modulating Microglia Activation and via TREM2/PI3K/AKT Pathway in APP/PS1 Mice. Basic & clinical pharmacology & toxicology, 2025 (PubMed: 39948751) [IF=2.7]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.