Product: HSP27 Antibody
Catalog: AF6082
Description: Rabbit polyclonal antibody to HSP27
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Rabbit, Dog, Xenopus
Mol.Wt.: 27kDa(Observed); 23kD(Calculated).
Uniprot: P04792
RRID: AB_2834851

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Pig(91%), Zebrafish(%), Bovine(%), Horse(%), Rabbit(%), Dog(%), Xenopus(%)
Clonality:
Polyclonal
Specificity:
HSP27 Antibody detects endogenous levels of total HSP27.
RRID:
AB_2834851
Cite Format: Affinity Biosciences Cat# AF6082, RRID:AB_2834851.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Heat shock 27kDa protein; 28 kDa heat shock protein; CMT2F; DKFZp586P1322; epididymis secretory protein Li 102; Estrogen regulated 24 kDa protein; Estrogen-regulated 24 kDa protein; Heat shock 25kDa protein 1; Heat shock 27 kDa protein; Heat shock 27kD protein 1; Heat shock 27kDa protein 1; Heat shock 28kDa protein 1; Heat Shock Protein 27; Heat shock protein beta 1; Heat shock protein beta-1; heat shock protein family B (small) member 1; HEL-S-102; HMN2B; HS.76067; Hsp 25; HSP 27; Hsp 28; Hsp B1; Hsp25; HSP27; Hsp28; HspB1; HSPB1_HUMAN; SRP27; Stress responsive protein 27; Stress-responsive protein 27;

Immunogens

Immunogen:

A synthesized peptide derived from human HSP27, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P04792 HSPB1_HUMAN:

Detected in all tissues tested: skeletal muscle, heart, aorta, large intestine, small intestine, stomach, esophagus, bladder, adrenal gland, thyroid, pancreas, testis, adipose tissue, kidney, liver, spleen, cerebral cortex, blood serum and cerebrospinal fluid. Highest levels are found in the heart and in tissues composed of striated and smooth muscle.

Description:
HSP27 is a small heat shock protein that is regulated both transcriptionally and posttranslationally. Modulates actin polymerization and reorganization.
Sequence:
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Bovine
100
Dog
100
Rabbit
100
Pig
91
Xenopus
91
Zebrafish
91
Sheep
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Plays a role in stress resistance and actin organization. Through its molecular chaperone activity may regulate numerous biological processes including the phosphorylation and the axonal transport of neurofilament proteins.

PTMs:

Phosphorylated upon exposure to protein kinase C activators and heat shock. Phosphorylation by MAPKAPK2 and MAPKAPK3 in response to stress dissociates HSPB1 from large small heat-shock protein (sHsps) oligomers and impairs its chaperone activity and ability to protect against oxidative stress effectively. Phosphorylation by MAPKAPK5 in response to PKA stimulation induces F-actin rearrangement.

Subcellular Location:

Cytoplasm. Nucleus. Cytoplasm>Cytoskeleton>Spindle.
Note: Cytoplasmic in interphase cells. Colocalizes with mitotic spindles in mitotic cells. Translocates to the nucleus during heat shock and resides in sub-nuclear structures known as SC35 speckles or nuclear splicing speckles.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Detected in all tissues tested: skeletal muscle, heart, aorta, large intestine, small intestine, stomach, esophagus, bladder, adrenal gland, thyroid, pancreas, testis, adipose tissue, kidney, liver, spleen, cerebral cortex, blood serum and cerebrospinal fluid. Highest levels are found in the heart and in tissues composed of striated and smooth muscle.

Family&Domains:

Belongs to the small heat shock protein (HSP20) family.

Research Fields

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.

· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.

References

1). Exosomes derived from dental pulp stem cells accelerate cutaneous wound healing by enhancing angiogenesis via the Cdc42/p38 MAPK pathway. International Journal of Molecular Medicine, 2022 (PubMed: 36321793) [IF=5.7]

Application: WB    Species: Human    Sample:

Figure 4 - DPSC-Exos promote angiogenesis via p38 MAPK to promote wound healing. (A and B) HUVECs were treated with DPSC-Exos in the presence or absence of SB203580. The expression of p38, p-p38, hsp27 and p-hsp27 was detected using western blot analysis (n=3). (C and D) The migration of HUVECs stimulated by DPSC-Exos or an equal volume of PBS in the presence or absence of SB203580 (n=3). Scale bar, 100 µm. (E and F) Representative images of scratch wound assay in HUVECs treated with DPSC-Exos or PBS in the presence or absence of SB203580 (n=3). Scale bar, 100 µm. (G) The proliferation of HUVECs receiving different treatments were examined using CCK-8 assay (n=3). (H-J) Representative images of the tube formation assay on Matrigel in HUVECs treated with DPSC-Exos or PBS (n=3). Scale bar, 100 µm. *P

2). Isobaric Tags for Relative and Absolute Quantitation (iTRAQ)-Based Proteomic Analysis of Hugan Qingzhi and Its Protective Properties against Free Fatty Acid-Induced L02 Hepatocyte Injury. Frontiers in Pharmacology, 2017 (PubMed: 28293193) [IF=5.6]

Application: WB    Species: human    Sample:

FIGURE 6 | Effects of HQT-medicated serum on amount of phosphorylated HSP27 and total HSP27 (A,B) and phosphorylation level of HSP27 (A,C) in FFA-stimulated L02 hepatocytes over 24 h. GAPDH was used as a loading control. Values are expressed as mean ± SD in each group. ∗∗p < 0.01 vs. control group; ##p < 0.01 vs. FFA group.

3). A Group of Complexes Based on PAMAM and Quantum Dots Used in Clinical Immunoassays. Nanoscale Research Letters, 2020 (PubMed: 32246298) [IF=5.5]

4). Effects of electroacupuncture on rats with cognitive impairment: An iTRAQ-based proteomics analysis. Journal of integrative medicine, 2023 (PubMed: 36424268) [IF=4.2]

5). Novel methyltransferase G9a inhibitor induces ferroptosis in multiple myeloma through Nrf2/HO-1 pathway. Annals of hematology, 2024 (PubMed: 38538975) [IF=3.0]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.