| Product: | ENOPH1 Antibody |
| Catalog: | DF12977 |
| Description: | Rabbit polyclonal antibody to ENOPH1 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat, Monkey |
| Prediction: | Pig, Bovine, Horse, Rabbit, Dog |
| Mol.Wt.: | 29 kDa(Observed); 29kD(Calculated). |
| Uniprot: | Q9UHY7 |
| RRID: | AB_2845938 |
Control Products
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12977, RRID:AB_2845938.
Fold/Unfold
2 3 diketo 5 methylthio 1 phosphopentane phosphatase; 2; 3-diketo-5-methylthio-1-phosphopentane phosphatase; Acireductone synthase; DKFZp586M0524; E 1 enzyme; E1; Enolase phosphatase 1; Enolase phosphatase E1; Enolase-phosphatase E1; ENOPH_HUMAN; Enoph1; FLJ12594; MASA homolog; MST145; MSTP145 protein;
Immunogens
A synthesized peptide derived from human ENOPH1, corresponding to a region within C-terminal amino acids.
- Q9UHY7 ENOPH_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).
Cytoplasm. Nucleus.
Belongs to the HAD-like hydrolase superfamily. MasA/MtnC family.
Research Fields
· Metabolism > Amino acid metabolism > Cysteine and methionine metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.