Product: Phospho-LKB1 (Ser428) Antibody
Catalog: AF3453
Description: Rabbit polyclonal antibody to Phospho-LKB1 (Ser428)
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Monkey
Prediction: Pig, Bovine, Horse, Sheep, Dog, Xenopus
Mol.Wt.: 65kDa; 49kD(Calculated).
Uniprot: Q15831
RRID: AB_2834891

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Monkey
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Dog(100%), Xenopus(89%)
Clonality:
Polyclonal
Specificity:
Phospho-LKB1 (Ser428) Antibody detects endogenous levels of LKB1 only when phosphorylated at Serine 428.
RRID:
AB_2834891
Cite Format: Affinity Biosciences Cat# AF3453, RRID:AB_2834891.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

hLKB1; Liver kinase B1; LKB1; PJS; Polarization related protein LKB1; Renal carcinoma antigen NY-REN-19; Serine/Threonine Kinase 11; Serine/threonine protein kinase 11; Serine/threonine protein kinase LKB1; Serine/threonine protein kinase STK11; Serine/threonine-protein kinase 11; Serine/threonine-protein kinase LKB1; Serine/threonine-protein kinase XEEK1; Stk11; STK11_HUMAN;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q15831 STK11_HUMAN:

Ubiquitously expressed. Strongest expression in testis and fetal liver.

Description:
ubiquitously expressed kinase of the CAMKL family with a tumor suppressor activity. Phosphorylates AGS3 (activator of G-protein signaling 3) GPR domains, regulating the interaction of GPR-containing proteins with G-proteins. Strongest expression in testis and fetal liver. Mutations in LKB1 lead to the Peutz-Jeghers cancer syndrome.
Sequence:
MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSACKQQ

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
89
Zebrafish
78
Chicken
78
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q15831 As Substrate

Site PTM Type Enzyme
S31 Phosphorylation
T32 Phosphorylation
Y36 Phosphorylation P06239 (LCK)
K44 Acetylation
K48 Acetylation
K64 Acetylation
K96 Acetylation
K97 Acetylation
K178 Sumoylation
T185 Phosphorylation Q15831 (STK11)
T189 Phosphorylation Q15831 (STK11)
S240 Phosphorylation
Y261 Phosphorylation P06239 (LCK) , P06241 (FYN)
K296 Acetylation
S307 Phosphorylation Q05513 (PRKCZ)
K311 Acetylation
S325 Phosphorylation
S334 Phosphorylation
T336 Phosphorylation Q15831 (STK11)
Y362 Phosphorylation P06241 (FYN) , P06239 (LCK)
T363 Phosphorylation Q15831 (STK11) , P78527 (PRKDC) , Q13315 (ATM)
T367 Phosphorylation Q13315 (ATM)
S401 Phosphorylation
T402 Phosphorylation Q15831 (STK11)
S404 Phosphorylation
K416 Acetylation
K423 Acetylation
S428 Phosphorylation Q9UK32 (RPS6KA6) , Q05513 (PRKCZ) , P27361 (MAPK3) , P28482 (MAPK1) , O75582 (RPS6KA5) , Q15831 (STK11) , Q15418 (RPS6KA1) , P17612 (PRKACA)
K431 Acetylation

PTMs - Q15831 As Enzyme

Substrate Site Source
O60285 (NUAK1) T211 Uniprot
P04637 (TP53) S15 Uniprot
P04637 (TP53) S392 Uniprot
P27448 (MARK3) T211 Uniprot
P27448 (MARK3) S215 Uniprot
P43268 (ETV4) S396 Uniprot
P49841 (GSK3B) S9 Uniprot
P54646 (PRKAA2) T172 Uniprot
P54646 (PRKAA2) T485 Uniprot
P57059 (SIK1) T182 Uniprot
P60484 (PTEN) S380 Uniprot
P60484 (PTEN) T382 Uniprot
P60484 (PTEN) T383 Uniprot
P60484 (PTEN) S385 Uniprot
Q13131 (PRKAA1) T183 Uniprot
Q13153 (PAK1) T109 Uniprot
Q13485 (SMAD4) T77 Uniprot
Q14680 (MELK) T167 Uniprot
Q15831 (STK11) T185 Uniprot
Q15831 (STK11) T189 Uniprot
Q15831 (STK11) T336 Uniprot
Q15831 (STK11) T363 Uniprot
Q15831 (STK11) T402 Uniprot
Q15831 (STK11) S428 Uniprot
Q7KZI7 (MARK2) T208 Uniprot
Q7RTN6-5 (STRADA) T271 Uniprot
Q7RTN6-3 (STRADA) T292 Uniprot
Q7RTN6 (STRADA) T329 Uniprot
Q7RTN6-5 (STRADA) T361 Uniprot
Q7RTN6-3 (STRADA) T382 Uniprot
Q7RTN6-1 (STRADA) T419 Uniprot
Q8IWQ3 (BRSK2) T174 Uniprot
Q8TDC3 (BRSK1) T189 Uniprot
Q8TDC3-2 (BRSK1) T205 Uniprot
Q96L34 (MARK4) T214 Uniprot
Q9H093 (NUAK2) T208 Uniprot
Q9H0K1 (SIK2) T175 Uniprot
Q9NRH2-1 (SNRK) T173 Uniprot
Q9P0L2-1 (MARK1) T215 Uniprot
Q9P0L2-1 (MARK1) S219 Uniprot

Research Backgrounds

Function:

Tumor suppressor serine/threonine-protein kinase that controls the activity of AMP-activated protein kinase (AMPK) family members, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage response. Acts by phosphorylating the T-loop of AMPK family proteins, thus promoting their activity: phosphorylates PRKAA1, PRKAA2, BRSK1, BRSK2, MARK1, MARK2, MARK3, MARK4, NUAK1, NUAK2, SIK1, SIK2, SIK3 and SNRK but not MELK. Also phosphorylates non-AMPK family proteins such as STRADA, PTEN and possibly p53/TP53. Acts as a key upstream regulator of AMPK by mediating phosphorylation and activation of AMPK catalytic subunits PRKAA1 and PRKAA2 and thereby regulates processes including: inhibition of signaling pathways that promote cell growth and proliferation when energy levels are low, glucose homeostasis in liver, activation of autophagy when cells undergo nutrient deprivation, and B-cell differentiation in the germinal center in response to DNA damage. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton. Required for cortical neuron polarization by mediating phosphorylation and activation of BRSK1 and BRSK2, leading to axon initiation and specification. Involved in DNA damage response: interacts with p53/TP53 and recruited to the CDKN1A/WAF1 promoter to participate in transcription activation. Able to phosphorylate p53/TP53; the relevance of such result in vivo is however unclear and phosphorylation may be indirect and mediated by downstream STK11/LKB1 kinase NUAK1. Also acts as a mediator of p53/TP53-dependent apoptosis via interaction with p53/TP53: translocates to the mitochondrion during apoptosis and regulates p53/TP53-dependent apoptosis pathways. In vein endothelial cells, inhibits PI3K/Akt signaling activity and thus induces apoptosis in response to the oxidant peroxynitrite (in vitro). Regulates UV radiation-induced DNA damage response mediated by CDKN1A. In association with NUAK1, phosphorylates CDKN1A in response to UV radiation and contributes to its degradation which is necessary for optimal DNA repair.

Has a role in spermiogenesis.

PTMs:

Phosphorylated by ATM at Thr-363 following ionizing radiation (IR). Phosphorylation at Ser-428 by RPS6KA1 and/or some PKA is required to inhibit cell growth. Phosphorylation at Ser-428 is also required during neuronal polarization to mediate phosphorylation of BRSK1 and BRSK2 (By similarity). Phosphorylation by PKC/PRKCZ at Ser-428 promotes peroxynitrite-induced nuclear export of STK11, leading to PTEN activation and subsequent inhibition of AKT signaling. Phosphorylation by PKC/PRKCZ at Ser-399 in isoform 2 promotes metformin (or peroxynitrite)-induced nuclear export of STK11 and activation of AMPK. UV radiation-induced phosphorylation at Thr-363 mediates CDKN1A degradation (By similarity).

Acetylated. Deacetylation at Lys-48 enhances cytoplasmic localization and kinase activity in vitro.

Subcellular Location:

Nucleus. Cytoplasm. Membrane. Mitochondrion.
Note: A small fraction localizes at membranes (By similarity). Relocates to the cytoplasm when bound to STRAD (STRADA or STRADB) and CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta). Translocates to the mitochondrion during apoptosis. Translocates to the cytoplasm in response to metformin or peroxynitrite treatment. PTEN promotes cytoplasmic localization.

Nucleus. Cytoplasm.
Note: Predominantly nuclear, but translocates to the cytoplasm in response to metformin or peroxynitrite treatment.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitously expressed. Strongest expression in testis and fetal liver.

Subunit Structure:

Catalytic component of a trimeric complex composed of STK11/LKB1, STRAD (STRADA or STRADB) and CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta): the complex tethers STK11/LKB1 in the cytoplasm and stimulates its catalytic activity. Found in a ternary complex composed of SMAD4, STK11/LKB1 and STK11IP. Interacts with p53/TP53, SMAD4, STK11IP and WDR6. Interacts with NR4A1. Interacts with NISCH; this interaction may increase STK11 activity. Interacts with PTEN; leading to PTEN phosphorylation. Interacts with SIRT1; the interaction deacetylates STK11. Interacts with CDKN1A.

Family&Domains:

Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. LKB1 subfamily.

Research Fields

· Cellular Processes > Transport and catabolism > Autophagy - animal.   (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Tight junction.   (View pathway)

· Environmental Information Processing > Signal transduction > FoxO signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > mTOR signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > AMPK signaling pathway.   (View pathway)

· Organismal Systems > Aging > Longevity regulating pathway.   (View pathway)

· Organismal Systems > Endocrine system > Adipocytokine signaling pathway.

References

1). Zhang J et al. Ginsenoside CK ameliorates hepatic lipid accumulation via activating the LKB1/AMPK pathway in vitro and in vivo. Food & Function 2022 Feb 7;13(3):1153-1167. (PubMed: 35018944) [IF=6.1]

2). Xie F et al. Metformin protects against ethanol-induced liver triglyceride accumulation by the LKB1/AMPK/ACC pathway. MOLECULAR BIOLOGY REPORTS 2022 Jun 22. (PubMed: 35733070) [IF=2.8]

3). Zhang SX et al. Mechanism of N-Methyl-N-Nitroso-Urea-Induced Gastric Precancerous Lesions in Mice. Journal of Oncology 2022 Mar 16;2022:3780854. (PubMed: 35342404)

4). Mechanism of Hypoxia-Activated MiR-194 /FoxO3a Inducing Glycolytic Metabolism Reprogramming in Gastric Precancerous Lesions. Research Square

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.