Product: Apelin Antibody
Catalog: DF13350
Description: Rabbit polyclonal antibody to Apelin
Application: WB IHC IF/ICC
Cited expt.: IHC, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Sheep, Rabbit
Mol.Wt.: 8kDa; 9kD(Calculated).
Uniprot: Q9ULZ1
RRID: AB_2846369

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Sheep(100%), Rabbit(100%)
Clonality:
Polyclonal
Specificity:
Apelin Antibody detects endogenous levels of total Apelin.
RRID:
AB_2846369
Cite Format: Affinity Biosciences Cat# DF13350, RRID:AB_2846369.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AGTRL1 ligand; APEL; APEL_HUMAN; Apelin-13; APJ endogenous ligand; Apln; XNPEP2;

Immunogens

Immunogen:

A synthesized peptide derived from human Apelin, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q9ULZ1 APEL_HUMAN:

Expressed in the brain with highest levels in the frontal cortex, thalamus, hypothalamus and midbrain (PubMed:10617103). Secreted by the mammary gland into the colostrum and the milk.

Sequence:
MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
100
Sheep
100
Rabbit
100
Horse
0
Dog
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Endogenous ligand for the apelin receptor (APLNR). Drives internalization of the apelin receptor (By similarity). Apelin-36 dissociates more hardly than (pyroglu)apelin-13 from APLNR (By similarity). Hormone involved in the regulation of cardiac precursor cell movements during gastrulation and heart morphogenesis (By similarity). Has an inhibitory effect on cytokine production in response to T-cell receptor/CD3 cross-linking; the oral intake of apelin in the colostrum and the milk might therefore modulate immune responses in neonates (By similarity). Plays a role in early coronary blood vessels formation (By similarity). Mediates myocardial contractility in an ERK1/2-dependent manner (By similarity). May also have a role in the central control of body fluid homeostasis by influencing vasopressin release and drinking behavior (By similarity).

(Microbial infection) Endogenous ligand for the apelin receptor (APLNR), an alternative coreceptor with CD4 for HIV-1 infection. Inhibits HIV-1 entry in cells coexpressing CD4 and APLNR. Apelin-36 has a greater inhibitory activity on HIV infection than other synthetic apelin derivatives.

PTMs:

Several active peptides may be produced by proteolytic processing of the peptide precursor.

Subcellular Location:

Secreted. Secreted>Extracellular space.
Note: Abundantly secreted in the colostrum. Lower level in milk. Decreases rapidly within several days after parturition in milk, but is still detectable even in commercial milk.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in the brain with highest levels in the frontal cortex, thalamus, hypothalamus and midbrain. Secreted by the mammary gland into the colostrum and the milk.

Family&Domains:

Belongs to the apelin family.

Research Fields

· Environmental Information Processing > Signal transduction > Apelin signaling pathway.   (View pathway)

References

1). A reactive oxygen species-responsive hydrogel loaded with Apelin-13 promotes the repair of spinal cord injury by regulating macrophage M1/M2 polarization and neuroinflammation. Journal of nanobiotechnology, 2025 (PubMed: 39794784) [IF=10.2]

2). The Protective Role of Apelin in the Early Stages of Diabetic Retinopathy. International Journal of Molecular Sciences, 2022 (PubMed: 36499009) [IF=5.6]

Application: IF/ICC    Species: Mouse    Sample:

Figure 2 The expression of apelin in DR mice treated with LV-EGFP, LV-Apelin+, or LV-Apelin−. (A) Representative apelin staining images by CLSM and (B) the quantification of the staining intensity indicated that apelin was moderately expressed in the LV-EGFP group and was primarily distributed in the GCL, while it was widely expressed in the LV-Apelin+ group and distributed in the GCL and INL. In the LV-Apelin− group, there was almost no expression of apelin. (C) The qRT-PCR results revealed that the mRNA expression of apelin was upregulated in the LV-Apelin+ group, but downregulated in the LV-Apelin− group. Blue: DAPI, red: apelin. GCL: ganglion cell layer; INL: inner nuclear layer; ONL: outer nuclear layer. Data were expressed as mean ± SD. LV-Apelin+ versus LV-EGFP; LV-Apelin− versus LV-EGFP;

3). Melatonin protects against myocardial ischemia-reperfusion injury by inhibiting excessive mitophagy through the Apelin/SIRT3 signaling axis. European journal of pharmacology, 2024 (PubMed: 38128867) [IF=4.2]

4). Mangiferin attenuates lipopolysaccharide-induced neuronal injuries in primary cultured hippocampal neurons. Aging, 2024 (PubMed: 38752883) [IF=3.9]

5). Differential Gene Expression Profiling in Alveolar Echinococcosis Identifies Potential Biomarkers Associated With Angiogenesis. Open Forum Infectious Diseases, 2023 (PubMed: 36817746) [IF=3.8]

Application: IHC    Species: Human    Sample: AE samples

Figure 5. Immunohistochemical analysis of CD34, vascular endothelial growth factor (VEGF), and angiogenesis-related differentially expressed genes in the experimental (alveolar echinococcosis [AE]) and control (AE control group [AEC]) group samples. (A) CD34 and VEGF staining in AE samples showed different degrees of vascularization. Increased expression of SPP1, RSPO3, APLN, TWIST1, ADAM12, and FOXC2 was observed in the AE samples, whereas low or no expression of these genes was observed in the AEC samples. (B) The H-scores of CD34, VEGF, SPP1, RSPO3, APLN, TWIST1, ADAM12, and FOXC2 were significantly higher in the AE samples than in the AEC samples (values represent the mean ± standard error of the mean: ∗∗∗P < .001, ∗∗∗∗P < .0001).

6). Cholecystokinin regulates atrial natriuretic peptide secretion through activation of NOX4-Sirt1-LEF1 signaling in beating rat hypoxic atria. Peptides, 2024 (PubMed: 39326462) [IF=2.8]

7). Expression of the apelin system in the porcine pituitary during the oestrous cycle and early pregnancy and the effect of apelin on LH and FSH secretion. Theriogenology, 2024 (PubMed: 39357165) [IF=2.4]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.