GCP2 Antibody - #DF13470
| Product: | GCP2 Antibody |
| Catalog: | DF13470 |
| Description: | Rabbit polyclonal antibody to GCP2 |
| Application: | WB IHC IF/ICC |
| Cited expt.: | IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Bovine |
| Mol.Wt.: | 11kDa; 12kD(Calculated). |
| Uniprot: | P80162 |
| RRID: | AB_2846489 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13470, RRID:AB_2846489.
Fold/Unfold
C X C motif chemokine 6; Chemokine (C X C motif) ligand 6; Chemokine alpha 3; CKA 3; CKA-3; CKA3; CXCL 6; CXCL6; CXCL6_HUMAN; GCP 2; GCP-2; Granulocyte chemotactic protein 2; N-processed variant 3; SCYB6; Small inducible cytokine B6; Small inducible cytokine subfamily B (Cys X Cys) member 6; Small inducible cytokine subfamily B (Cys X Cys) member b; Small-inducible cytokine B6;
Immunogens
A synthesized peptide derived from human GCP2, corresponding to a region within the internal amino acids.
- P80162 CXCL6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Chemotactic for neutrophil granulocytes. Signals through binding and activation of its receptors (CXCR1 and CXCR2). In addition to its chemotactic and angiogenic properties, it has strong antibacterial activity against Gram-positive and Gram-negative bacteria (90-fold-higher when compared to CXCL5 and CXCL7).
Secreted.
Belongs to the intercrine alpha (chemokine CxC) family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Human Diseases > Infectious diseases: Bacterial > Pertussis.
· Human Diseases > Immune diseases > Rheumatoid arthritis.
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
· Organismal Systems > Immune system > IL-17 signaling pathway. (View pathway)
References
Application: IHC Species: Mice Sample: liver tissues
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.