Product: Smad7 Antibody
Catalog: AF6827
Description: Rabbit polyclonal antibody to Smad7
Application: ELISA(peptide)
Reactivity: Human, Mouse, Rat
Mol.Wt.: 50kD(Observed); 46kD(Calculated).
Uniprot: O15105
RRID: AB_2847550

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Polyclonal
Specificity:
Smad7 Antibody detects endogenous levels of total Smad7.
RRID:
AB_2847550
Cite Format: Affinity Biosciences Cat# AF6827, RRID:AB_2847550.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CRCS3; FLJ16482; hSMAD 7; hSMAD7; MAD (mothers against decapentaplegic Drosophila) homolog 7; MAD; Mad homolog 7; MAD homolog 8; MAD mothers against decapentaplegic homolog 7; MADH 7; MADH 8; MADH6; MADH7; MADH8; Mothers Against Decapentaplegic Drosophila Homolog of 6; Mothers Against Decapentaplegic Drosophila Homolog of 7; Mothers against decapentaplegic homolog 7; Mothers against decapentaplegic homolog 8; Mothers against DPP homolog 7; Mothers against DPP homolog 8; SMA- AND MAD-RELATED PROTEIN 7; SMAD 7; SMAD; SMAD family member 7; SMAD, mothers against DPP homolog 7 (Drosophila); SMAD, mothers against DPP homolog 7; SMAD6; Smad7; SMAD7_HUMAN;

Immunogens

Immunogen:

A synthesized peptide derived from human Smad7.

Uniprot:
Gene(ID):
Expression:
O15105 SMAD7_HUMAN:

Ubiquitous with higher expression in the lung and vascular endothelium.

Sequence:
MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGCCLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEVIFNSR

Research Backgrounds

Function:

Antagonist of signaling by TGF-beta (transforming growth factor) type 1 receptor superfamily members; has been shown to inhibit TGF-beta (Transforming growth factor) and activin signaling by associating with their receptors thus preventing SMAD2 access. Functions as an adapter to recruit SMURF2 to the TGF-beta receptor complex. Also acts by recruiting the PPP1R15A-PP1 complex to TGFBR1, which promotes its dephosphorylation. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.

PTMs:

Phosphorylation on Ser-249 does not affect its stability, nuclear localization or inhibitory function in TGFB signaling; however it affects its ability to regulate transcription (By similarity). Phosphorylated by PDPK1.

Ubiquitinated by WWP1 (By similarity). Polyubiquitinated by RNF111, which is enhanced by AXIN1 and promotes proteasomal degradation. In response to TGF-beta, ubiquitinated by SMURF1; which promotes its degradation.

Acetylation prevents ubiquitination and degradation mediated by SMURF1.

Subcellular Location:

Nucleus. Cytoplasm.
Note: Interaction with NEDD4L or RNF111 induces translocation from the nucleus to the cytoplasm (PubMed:16601693). TGF-beta stimulates its translocation from the nucleus to the cytoplasm. PDPK1 inhibits its translocation from the nucleus to the cytoplasm in response to TGF-beta (PubMed:17327236).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitous with higher expression in the lung and vascular endothelium.

Family&Domains:

Belongs to the dwarfin/SMAD family.

Research Fields

· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Hippo signaling pathway.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.