Product: HAT Antibody
Catalog: AF0269
Description: Rabbit polyclonal antibody to HAT
Application: WB IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 49kDa; 50kD(Calculated).
Uniprot: O14929
RRID: AB_2833443

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(92%)
Clonality:
Polyclonal
Specificity:
HAT Antibody detects endogenous levels of total HAT.
RRID:
AB_2833443
Cite Format: Affinity Biosciences Cat# AF0269, RRID:AB_2833443.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

HAT 1; hat1; HAT1_HUMAN; Histidine aminotransferase 1; Histone acetyltransferase 1; Histone acetyltransferase 1; Histone acetyltransferase type B catalytic subunit; KAT1;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
HAT1 May play a role in telomeric silencing. Acetylates soluble but not nucleosomal H4 at 'Lys-5' and 'Lys-12' and acetylates histone H2A at 'Lys-5'. HAT1 has intrinsic substrate specificity that modifies lysine in recognition sequence GXGKXG. Belongs to the HAT1 family.
Sequence:
MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Chicken
92
Xenopus
67
Zebrafish
67
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - O14929 As Substrate

Site PTM Type Enzyme
A2 Acetylation
K9 Ubiquitination
K15 Acetylation
K15 Ubiquitination
K26 Ubiquitination
K36 Ubiquitination
T50 Phosphorylation
Y55 Phosphorylation
Y69 Phosphorylation
K70 Ubiquitination
Y78 Phosphorylation
S93 Phosphorylation
C101 S-Nitrosylation
K110 Ubiquitination
S190 Phosphorylation
T245 Phosphorylation
K280 Acetylation
K280 Ubiquitination
R286 Methylation
K304 Ubiquitination
K320 Ubiquitination
S343 Phosphorylation
S350 Phosphorylation
Y351 Phosphorylation
S361 Phosphorylation
Y363 Phosphorylation

Research Backgrounds

Function:

Acetylates soluble but not nucleosomal histone H4 at 'Lys-5' (H4K5ac) and 'Lys-12' (H4K12ac) and, to a lesser extent, acetylates histone H2A at 'Lys-5' (H2AK5ac). Has intrinsic substrate specificity that modifies lysine in recognition sequence GXGKXG. May be involved in nucleosome assembly during DNA replication and repair as part of the histone H3.1 and H3.3 complexes. May play a role in DNA repair in response to free radical damage.

Subcellular Location:

Nucleus matrix.

Cytoplasm. Nucleus. Nucleus matrix. Nucleus>Nucleoplasm.
Note: Localization is predominantly nuclear in normal cells. Treatment with hydrogen peroxide or ionizing radiation enhances nuclear localization through redistribution of existing protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Catalytic subunit of the type B histone acetyltransferase (HAT) complex, composed of RBBP7 and HAT1. Interacts with histones H4 and H2A. The interaction is dependent of the ability of RBBP7 to bind to the N-terminus of histones. Component of the histone H3.1 and H3.3 complexes.

Family&Domains:

Belongs to the HAT1 family.

Research Fields

· Human Diseases > Substance dependence > Alcoholism.

References

1). A novel lncRNA SNHG29 regulates EP300- related histone acetylation modification and inhibits FLT3-ITD AML development. Leukemia (PubMed: 37157016) [IF=11.4]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.