Product: Cyclin D3 Antibody
Catalog: AF6251
Description: Rabbit polyclonal antibody to Cyclin D3
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat, Monkey
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 32kDa; 33kD(Calculated).
Uniprot: P30281
RRID: AB_2835115

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Monkey
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%)
Clonality:
Polyclonal
Specificity:
Cyclin D3 Antibody detects endogenous levels of total Cyclin D3.
RRID:
AB_2835115
Cite Format: Affinity Biosciences Cat# AF6251, RRID:AB_2835115.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CCND 3; Ccnd3; CCND3_HUMAN; CyclinD3; D3 type cyclin; G1 S specific cyclin D3; G1/S specific cyclin D3; G1/S-specific cyclin-D3;

Immunogens

Immunogen:

A synthesized peptide derived from human Cyclin D3, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Description:
CCND3 Regulatory component of the cyclin D3-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition.
Sequence:
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Chicken
100
Rabbit
100
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Regulatory component of the cyclin D3-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D3/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex.

PTMs:

Polyubiquitinated by the SCF(FBXL2) complex, leading to proteasomal degradation.

Subcellular Location:

Nucleus. Cytoplasm. Membrane.
Note: Cyclin D-CDK4 complexes accumulate at the nuclear membrane and are then translocated to the nucleus through interaction with KIP/CIP family members.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the cyclin family. Cyclin D subfamily.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

· Cellular Processes > Cell growth and death > p53 signaling pathway.   (View pathway)

· Cellular Processes > Cell growth and death > Cellular senescence.   (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Wnt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Hippo signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Viral > Measles.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

References

1). d-Borneol enhances cisplatin sensitivity via p21/p27-mediated S-phase arrest and cell apoptosis in non-small cell lung cancer cells and a murine xenograft model. Cellular & Molecular Biology Letters, 2022 (PubMed: 35883026) [IF=9.2]

2). Nr2e1 deficiency aggravates insulin resistance and chronic inflammation of visceral adipose tissues in a diet-induced obese mice model. LIFE SCIENCES, 2021 (PubMed: 33915130) [IF=5.2]

Application: WB    Species: Mice    Sample: adipose tissues

Fig. 5. Nr2e1 deficiency exacerbated inflammation in EAT. Comparison of the epididymal fat weight (A). The ratio of epididymal fat weight to the total body weight (B). The mRNA expression of F4/80 (C). The mRNA and protein expressions of IL-6, IL-1β, TNF- α and MCP-1 (E, F). The protein levels of p-IKKβ/IKKβ, p-P65/P65 (G, H). The data are expressed as means ± SEM. *P < 0.05, **P < 0.01. ns: not significant.

3). miR-140-y targets TCF4 to regulate the Wnt signaling pathway and promote embryonic feather follicle development in Hungarian white goose. Poultry science, 2024 (PubMed: 38350393) [IF=3.8]

Application: WB    Species: goose    Sample: fibroblast cells

Figure 8. miR-140-y overexpression suppresses the expression of Wnt pathway related genes and inhibits the proliferation of dermal fibroblast cells. (A) Relative mRNA expression of Wnt pathway related genes was measured in dermal fibroblast cells 24 h after transfection with NC or miR-140-y mimics by qPCR. (B–C) Relative protein expression of Wnt pathway related genes was measured in dermal fibroblast cells 72 h after transfection with NC or miR-140-y mimics by Western blot. (D–E) Representative observations of the EdU assay of dermal fibroblast cells after transfection with NC and miR-140-y mimics (Bars: 100 µm). Red illustrate the EdU staining and blue display the cell nuclei stained with Hoechst 33342. (F) The mRNA expression of proliferation related gene (PCNA). (G-H) Protein expression level of proliferation related gene (PCNA). The data were shown as mean ± SEM, n = 3, * p < 0.05, ** p < 0.01.

4). Delactylation diminished the growth inhibitory role of CA3 by restoring DUOX2 expression in hepatocellular carcinoma. Experimental cell research, 2025 (PubMed: 39710294) [IF=3.3]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.