Product: Synuclein alpha Antibody
Catalog: AF6285
Description: Rabbit polyclonal antibody to Synuclein alpha
Application: WB IHC IF/ICC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Rabbit, Dog, Chicken
Mol.Wt.: 18kDa(Observed); 14kD(Calculated).
Uniprot: P37840
RRID: AB_2835136

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Pig(100%), Bovine(%), Horse(%), Rabbit(%), Dog(%), Chicken(%)
Clonality:
Polyclonal
Specificity:
Synuclein alpha Antibody detects endogenous levels of total Synuclein alpha.
RRID:
AB_2835136
Cite Format: Affinity Biosciences Cat# AF6285, RRID:AB_2835136.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Alpha synuclein; Alpha-synuclein; Alpha-synuclein, isoform NACP140; alphaSYN; MGC105443; MGC110988; MGC127560; MGC64356; NACP; Non A beta component of AD amyloid; Non A4 component of amyloid; Non A4 component of amyloid precursor; Non-A beta component of AD amyloid; Non-A-beta component of alzheimers disease amyloid , precursor of; Non-A4 component of amyloid precursor; Non-A4 component of amyloid, precursor of; OTTHUMP00000218549; OTTHUMP00000218551; OTTHUMP00000218552; OTTHUMP00000218553; OTTHUMP00000218554; PARK 1; PARK 4; PARK1; PARK4; Parkinson disease (autosomal dominant, Lewy body) 4; Parkinson disease familial 1; SNCA; Snca synuclein, alpha (non A4 component of amyloid precursor); SYN; Synuclein alpha; Synuclein alpha 140; Synuclein, alpha (non A4 component of amyloid precursor); SYUA_HUMAN;

Immunogens

Immunogen:

A synthesized peptide derived from human Synuclein alpha, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P37840 SYUA_HUMAN:

Highly expressed in presynaptic terminals in the central nervous system. Expressed principally in brain.

Description:
Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively.
Sequence:
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Dog
100
Rabbit
100
Chicken
85
Xenopus
77
Sheep
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release. Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores. Mechanistically, acts by increasing local Ca(2+) release from microdomains which is essential for the enhancement of ATP-induced exocytosis. Acts also as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs (Soluble NSF Attachment Protein REceptors) at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5. This chaperone activity is important to sustain normal SNARE-complex assembly during aging. Plays also a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter (DAT1) and thereby modulating its activity.

PTMs:

Phosphorylated, predominantly on serine residues. Phosphorylation by CK1 appears to occur on residues distinct from the residue phosphorylated by other kinases. Phosphorylation of Ser-129 is selective and extensive in synucleinopathy lesions. In vitro, phosphorylation at Ser-129 promoted insoluble fibril formation. Phosphorylated on Tyr-125 by a PTK2B-dependent pathway upon osmotic stress.

Hallmark lesions of neurodegenerative synucleinopathies contain alpha-synuclein that is modified by nitration of tyrosine residues and possibly by dityrosine cross-linking to generated stable oligomers.

Ubiquitinated. The predominant conjugate is the diubiquitinated form (By similarity).

Acetylation at Met-1 seems to be important for proper folding and native oligomeric structure.

Subcellular Location:

Cytoplasm. Membrane. Nucleus. Cell junction>Synapse. Secreted.
Note: Membrane-bound in dopaminergic neurons.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly expressed in presynaptic terminals in the central nervous system. Expressed principally in brain.

Family&Domains:

The 'non A-beta component of Alzheimer disease amyloid plaque' domain (NAC domain) is involved in fibrils formation. The middle hydrophobic region forms the core of the filaments. The C-terminus may regulate aggregation and determine the diameter of the filaments.

Belongs to the synuclein family.

Research Fields

· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.

· Human Diseases > Neurodegenerative diseases > Parkinson's disease.

References

1). Taraxasterol regulates p53 transcriptional activity to inhibit pancreatic cancer by inducing MDM2 ubiquitination degradation. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2024 (PubMed: 39671783) [IF=7.9]

2). Chelerythrine chloride inhibits the progression of colorectal cancer by targeting cancer-associated fibroblasts through intervention with WNT10B/β-catenin and TGFβ2/Smad2/3 axis. Phytotherapy research : PTR, 2023 (PubMed: 37402476) [IF=6.1]

3). Intranasal Administration of GRP78 Protein (HSPA5) Confers Neuroprotection in a Lactacystin-Induced Rat Model of Parkinson's Disease. International journal of molecular sciences, 2024 (PubMed: 38612761) [IF=5.6]

Application: WB    Species: Rat    Sample: nigral tissue

Figure 3 Exogenous GRP78 prevents abnormal accumulation of α-syn phosphorylated at S129 (pS129) in nigral tissue in rat model of Parkinson’s disease. Nigral content of (a) soluble form of α-syn, (b) α-syn phosphorylated at S129 (pS129), (c) phosphorylated to soluble α-syn ratio. Western blot analysis of nigral tissue was conducted with the antibodies against soluble and S129-phosphorylated forms of α-syn. Anti-GAPDH antibody staining was used as the loading control. (d) Representative Western blots are shown in panel. The results are presented as percentages of the control (100%) in (a–c) panels. Bar charts indicate mean values with standard errors. The dots, squares, triangles and rhombus show individual values per rat. Two-way ANOVA test followed by Tukey’s post hoc analysis were performed to determine the effects of GRP78 therapy. Asterisks indicate significant differences between groups according to Tukey’s post hoc tests

4). Protective effects and mechanism of Paecilomyces cicadae TJJ1213 intracellular polysaccharide against H2O2-induced PC12 cells damage. Chemical Biology & Drug Design, 2023 (PubMed: 37072242) [IF=3.2]

5). Comparing the effect of intravenous versus intracranial grafting of mesenchymal stem cells against parkinsonism in a rat model: Behavioral, biochemical, pathological and immunohistochemical studies. PloS one, 2024 (PubMed: 38349932) [IF=2.9]

Application: IHC    Species: Rat    Sample:

Fig 5 Representative images of each group of animals showing immunohistochemistry of endogenous α-Synclein expression in the Substania Nigra and Striatum. (Bar: 50 μm).

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.