CERS1 Antibody - #DF15450
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Ceramide synthase 1; CerS1; CERS1_HUMAN; LAG1; LAG1 homolog ceramide synthase 1; LAG1 longevity assurance homolog 1; LASS 1; LASS1; Longevity assurance (LAG1 S. cerevisiae) homolog 1; Longevity assurance gene 1; Longevity assurance gene 1 protein homolog 1; MGC90349; Protein LAG1; Protein UOG 1; Protein UOG-1; UOG 1 protein; UOG1; Upstream of GDF1;
Immunogens
A synthesized peptide derived from human CERS1.
- P27544 CERS1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAAGPAAGPTGPEPMPSYAQLVQRGWGSALAAARGCTDCGWGLARRGLAEHAHLAPPELLLLALGALGWTALRSAATARLFRPLAKRCCLQPRDAAKMPESAWKFLFYLGSWSYSAYLLFGTDYPFFHDPPSVFYDWTPGMAVPRDIAAAYLLQGSFYGHSIYATLYMDTWRKDSVVMLLHHVVTLILIVSSYAFRYHNVGILVLFLHDISDVQLEFTKLNIYFKSRGGSYHRLHALAADLGCLSFGFSWFWFRLYWFPLKVLYATSHCSLRTVPDIPFYFFFNALLLLLTLMNLYWFLYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
Research Backgrounds
Ceramide synthase that catalyzes formation of ceramide from sphinganine and acyl-CoA substrates, with high selectivity toward stearoyl-CoA (octadecanoyl-CoA; C18:0-CoA).
Acetylated. Deacetylation by SIRT3 increases enzyme activity and promotes mitochondrial ceramide accumulation.
Endoplasmic reticulum membrane>Multi-pass membrane protein.
Research Fields
· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway. (View pathway)
· Metabolism > Lipid metabolism > Sphingolipid metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.