ST3GAL4 Antibody - #DF15963
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Alpha 2 3 sialyltransferase IV; Alpha 2 3 ST; Alpha 3 N acetylneuraminyltransferase; Beta galactoside alpha 2 3 sialyltransferase; CGS23; CMP N acetylneuraminate beta galactosamide alpha 2 3 sialyltransferase; FLJ11867; FLJ46764; Gal NAc6S; NANTA3; SAT 3; SAT3; Sialyltransferase 4C (beta galactosidase alpha 2 3 sialytransferase); Sialyltransferase 4C (beta galactoside alpha 2 3 sialytransferase); SIAT4; SIAT4 C; SIAT4C; ST 4; ST3 beta galactoside alpha 2 3 sialyltransferase 4; ST3Gal III; ST3GAL4; ST3GalIV; ST4; STZ;
Immunogens
A synthesized peptide derived from human ST3GAL4.
- Q11206 SIA4C_HUMAN:
 - Protein BLAST With
 - NCBI/
 - ExPASy/
 - Uniprot
 
MVSKSRWKLLAMLALVLVVMVWYSISREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF
Research Backgrounds
Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, and NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. It may be involved in the biosynthesis of the sialyl Lewis X determinant.
The soluble form derives from the membrane form by proteolytic processing.
Golgi apparatus>Golgi stack membrane>Single-pass type II membrane protein. Secreted. 
Note: Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid.
Highly expressed in adult placenta, ovary and testes.
Belongs to the glycosyltransferase 29 family.
Research Fields
· Metabolism > Glycan biosynthesis and metabolism > Glycosphingolipid biosynthesis - lacto and neolacto series.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.