Cox1 Antibody | Affinity Biosciences

Cites

1/2

FIG 6 FbaA initiates autophagy upon Fn-mediated binding to integrin 51.

FIG 6 |FbaA initiates autophagy upon Fn-mediated binding to integrin 51.

Product:	Cox1 Antibody
Catalog:	AF7002
Description:	Rabbit polyclonal antibody to Cox1
Application:	WB IHC IF/ICC
Reactivity:	Human, Mouse, Rat, Pig
Prediction:	Pig, Horse, Rabbit, Dog
Mol.Wt.:	70kDa; 69kD(Calculated).
Uniprot:	P23219
RRID:	AB_2835310

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
50ul	$250	In stock
100ul	$350	In stock
200ul	$450	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat,Pig

Prediction:

Horse(92%), Rabbit(82%), Dog(83%)

Clonality:

Polyclonal

Specificity:

Cox1 Antibody detects endogenous levels of total Cox1.

RRID:

AB_2835310
Cite Format: Affinity Biosciences Cat# AF7002, RRID:AB_2835310.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

COX 1; COX 3; COX-1; COX1; Cox3; Cyclooxygenase 1; Cyclooxygenase 3, included; Cyclooxygenase-1; EC 1.14.99.1; Partial COX1 proteins, included; PCOX1; PGG/HS; PGH synthase 1; PGH1_HUMAN; PGHS-1; PGHS1; PHS 1; PHS1; Prostaglandin G/H synthase 1; Prostaglandin H2 synthase 1; Prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase); Prostaglandin-endoperoxide synthase 1; PTGHS; PTGS1;

Immunogens

Immunogen:

Uniprot:

P23219(PGH1_HUMAN) >>Visit HPA database.

Gene(ID):

PTGS1(5742)

Description:

COX-1 May play an important role in regulating or promoting cell proliferation in some normal and neoplastically transformed cells. Homodimer. Belongs to the prostaglandin G/H synthase family. 2 isoforms of the human protein are produced by alternative splicing.

Sequence:

P23219 PGH1_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species

Results

Score

Horse

Pig

Dog

Rabbit

Sheep

Bovine

Xenopus

Zebrafish

Chicken

Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P23219 As Substrate

P23219

Site	PTM Type	Source
Y54	Phosphorylation	Uniprot
T117	Phosphorylation	Uniprot
T220	Phosphorylation	Uniprot

Research Backgrounds

P23219_PGH1_HUMAN

Function:

Converts arachidonate to prostaglandin H2 (PGH2), a committed step in prostanoid synthesis. Involved in the constitutive production of prostanoids in particular in the stomach and platelets. In gastric epithelial cells, it is a key step in the generation of prostaglandins, such as prostaglandin E2 (PGE2), which plays an important role in cytoprotection. In platelets, it is involved in the generation of thromboxane A2 (TXA2), which promotes platelet activation and aggregation, vasoconstriction and proliferation of vascular smooth muscle cells.

Subcellular Location:

Microsome membrane>Peripheral membrane protein. Endoplasmic reticulum membrane>Peripheral membrane protein.

Subunit Structure:

Homodimer.

Family&Domains:

Belongs to the prostaglandin G/H synthase family.

Research Fields

· Metabolism > Lipid metabolism > Arachidonic acid metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Immune system > Platelet activation. (View pathway)

· Organismal Systems > Nervous system > Serotonergic synapse.

· Organismal Systems > Endocrine system > Regulation of lipolysis in adipocytes.

References

1). Wang J et al. Integrin 51, as a Receptor of Fibronectin, Binds the FbaA Protein of Group A Streptococcus To Initiate Autophagy during Infection. mBio 2020 Jun 9;11(3):e00771-20. (PubMed: 32518187) [IF=6.4]

Application: WB Species: Mouse Sample: Hep2 cells

FIG 6 FbaA initiates autophagy upon Fn-mediated binding to integrin 51. (A and B) Western blot analysis of TLR2 (A) and TLR4 (B) expression in Hep2 cells stimulated with FbaA for the indicated times. (C and D) Expression of LC3II in Hep2 cells with and without TLR2- or TLR4-specific siRNA following FbaA stimulation. (E) Schematic representation of the Fn subunit. Fn contains domain types I, II, and III. FnI is the region critical for binding to FnBP; FnIII9 and FnIII10 contain motifs that interact with integrins. (F) Hep2 cells were transfected with GST-FbaA, GST-FbaAFn, or GST (as a control), and the integrin 5 or 1 chain was measured after being pulled down with anti-GST Ab. (G) Expression of Fn, integrin 5, integrin 1, and LC3II in Hep2 cells stimulated with FbaA at the indicated concentrations, as analyzed by Western blotting. (H) Western blot analysis of LC3II expression in Hep2 cells stimulated with different concentrations of Fn and mock-FbaA or FbaA. (I to K) Expression of LC3II in Hep2 cells with or without specific siRNA against Fn, integrin 5, or integrin 1 following FbaA stimulation, as analyzed by Western blotting. (L and M) Fn, integrin 5, and integrin 1 knockdown cells were pretreated without (L) or with (M) rapamycin for 0.5 h and then infected with M1 GAS strain SF370 for 6 h. Numbers of CFU of M1 GAS strain SF370 were counted in the cells. (N) M1 GAS strain SF370-infected sh-Atg5-Hep2 cells with specific siRNA against Fn, integrin 5, or integrin 1. Numbers of CFU of M1 GAS strain SF370 were counted in the cells. *, P 0.05.

Application: WB Species: human Sample: Hep2 cells

FIG 6 |FbaA initiates autophagy upon Fn-mediated binding to integrin 51. (A and B) Western blot analysis of TLR2 (A) and TLR4 (B) expression in Hep2 cells stimulated with FbaA for the indicated times.

2). Jiao J et al. Mechanisms of pancreatic tumor suppression mediated by Xiang-lian pill: An integrated in silico exploration and experimental validation. JOURNAL OF ETHNOPHARMACOLOGY 2022 Nov 15;298:115586. (PubMed: 35931303) [IF=5.4]

3). Jiange Hao et al. Modulating Endogenous Oxygen Consumption Enhanced AIEgens-Mediated Photodynamic Therapy against Advanced Bladder Tumor. Particle & Particle Systems Characterization [IF=2.7]

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

Cox1 Antibody - #AF7002