Product: TIMP1 Antibody
Catalog: AF7007
Description: Rabbit polyclonal antibody to TIMP1
Application: WB IHC IF/ICC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Dog
Mol.Wt.: 24kDa(Observed); 23kD(Calculated).
Uniprot: P01033
RRID: AB_2835315

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Pig(85%), Bovine(%), Horse(%), Sheep(%), Dog(%)
Clonality:
Polyclonal
Specificity:
TIMP1 Antibody detects endogenous levels of total TIMP1.
RRID:
AB_2835315
Cite Format: Affinity Biosciences Cat# AF7007, RRID:AB_2835315.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Clgi; Collagenase inhibitor; Collagenase inhibitor, Human; EPA; EPO; Erythroid Potentiating Activity; Erythroid-potentiating activity; Fibroblast collagenase inhibitor; FLJ90373; HCI; Human Collagenase Inhibitor; Metalloproteinase inhibitor 1; Metalloproteinase inhibitor 1 precursor; OTTHUMP00000023214; TIMP 1; TIMP; TIMP metallopeptidase inhibitor 1; TIMP-1; Timp1; TIMP1 protein; TIMP1_HUMAN; Tissue Inhibitor of Metalloproteinase 1; Tissue inhibitor of metalloproteinases 1; Tissue inhibitor of metalloproteinases; Ttissue inhibitor of metalloproteinase 1 erythroid potentiating activity collagenase inhibitor;

Immunogens

Immunogen:

A synthesized peptide derived from human TIMP1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P01033 TIMP1_HUMAN:

Detected in rheumatoid synovial fluid (at protein level).

Description:
TIMP1 Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Also mediates erythropoiesis in vitro; but, unlike IL-3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-11, MMP-12, MMP-13 and MMP-16.
Sequence:
MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
92
Bovine
92
Sheep
92
Pig
85
Dog
85
Rabbit
77
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. Mediates erythropoiesis in vitro; but, unlike IL3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors.

PTMs:

The activity of TIMP1 is dependent on the presence of disulfide bonds.

N-glycosylated.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Detected in rheumatoid synovial fluid (at protein level).

Family&Domains:

Belongs to the protease inhibitor I35 (TIMP) family.

Research Fields

· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.   (View pathway)

References

1). Long-term simulated microgravity fosters carotid aging-like changes via Piezo1. Cardiovascular research, 2024 (PubMed: 38271270) [IF=10.2]

2). A biomaterial-based therapy using a sodium hyaluronate/bioglass composite hydrogel for the treatment of oral submucous fibrosis. Acta Biomaterialia, 2023 (PubMed: 36509401) [IF=9.4]

3). Autophagic-CTSB-inflammasome axis modulates hepatic stellate cells activation in arsenic-induced liver fibrosis. Chemosphere, 2020 (PubMed: 31669990) [IF=8.1]

Application: WB    Species: rat    Sample: HSC-t6 cells

Fig,5| NaAsO2-induced activation of NLRP3 inflammasome and HSCs were mediated by cytoplasmic CTSB. (A-C) HSC-t6 cells were pretreated with or without CA-074 me for 2 h and then treated with NaAsO2 for 24 h. (A) The cytoplasmic and lysosomal CTSB was detected by IF. White arrows indicate positive staining (Images are shown at 20×10 magnification). (B, C) The expression level of NLRP3,caspase-1 p20, IL-1β, Collagen-Ⅰ, a-SMA, MMP-1, and TIMP-1 were determined by Western blot.

Application: WB    Species: rat    Sample: livers

Fig.2 NaAsO2 induced autophagy, activation of NLRP3 inflammasome and 662 hepatic stellate cell in vivo. (A) The expression level of LC3 and p62 in rat livers 663 following exposure to NaAsO2. The protein fraction was analyzed by Western blot. (B) 664 The expression level of cytoplasmic CTSB in rat livers following exposure to NaAsO2. 665 The protein fraction was analyzed by Western blot. (C) The expression level of NLRP3 inflammasome-associated proteins in rat livers following exposure to NaAsO2. 667 The protein fraction was analyzed by Western blot. (D) The expression level of 668 Collagen- , α-SMA, MMP-1, and TIMP-1in rat livers following exposure to NaAsO2. 669 The protein fraction was analyzed by Western blot. (E) α-SMA was detected by IF. 670 White arrows indicate positive staining. Values are mean ± SD, and n = 5. *p < 0.05, 671 **p < 0.01 compared with the control group; Scale bar = 100 µm

4). Hydroxylsafflower yellow A modulates tumor vascularization in liver cancer through intercellular communication and extracellular matrix-receptor interactions. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2025 (PubMed: 41197344) [IF=6.7]

5). Disruption of cholesterol homeostasis triggers NLRP3-cGAS-STING axis-dependent hepatic fibrosis and honokiol intervention effects. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2025 (PubMed: 40449452) [IF=6.7]

6). Quercetin induces MGMT+ glioblastoma cells apoptosis via dual inhibition of Wnt3a/β-Catenin and Akt/NF-κB signaling pathways. Phytomedicine, 2023 (PubMed: 37451151) [IF=6.7]

7). OSMRβ-mediated signals on resident fibroblasts restore healing in diabetic skin wounds through promoting angiogenesis and granulation tissue formation. Communications biology, 2025 (PubMed: 41152472) [IF=5.9]

8). Chrysin ameliorates synovitis and fibrosis of osteoarthritic fibroblast-like synoviocytes in rats through PERK/TXNIP/NLRP3 signaling. Frontiers in Pharmacology, 2023 (PubMed: 37021049) [IF=5.6]

9). Effects of the Leptin-Mediated MAPK/ERK Signaling Pathway on Collagen II Expression in Knee Cartilage of Newborn Male Mice from Obese Maternal Offspring. Biomolecules, 2022 (PubMed: 35327669) [IF=5.5]

Application: WB    Species: Mouse    Sample:

Figure 6. Inhibition of MAPK/ERK signaling pathway altered the expression of collagen II, MMP1, and TIMP1 in vitro. (A) Representative western blot bands of the expression of collagen II, MMP1, and TIMP1 in the cell cytoplasm and p-ERK in the nucleus induced by leptin, PD98059, or dimethyl sulfoxide (DMSO) (carrier for PD98059) in vitro (n = 3, chondrocytes obtained from three separate repeated experiments). (B) Statistical analysis of relative protein levels. Results are expressed as mean ± SD. ns not significant, * p < 0.05, ** p < 0.01, and *** p < 0.001.

10). Phillygenin Inhibits TGF-β1-induced Hepatic Stellate Cell Activation and Inflammation: Regulation of the Bax/Bcl-2 and Wnt/β-catenin Pathways. Inflammation, 2024 (PubMed: 38393550) [IF=4.5]

Application: WB    Species: Mouse    Sample: mHSC

Fig. 5 PHI inhibited TGF-β1-induced HSC activation in mHSCs and LX-2 cells. b Western blotting analyses of α-SMA, Collagen I, TIMP1, and MMP2 in mHSCs.

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.