Product: SLC18A2 Mouse Monoclonal Antibody
Catalog: BF8107
Description: Mouse monoclonal antibody to SLC18A2
Application: WB
Reactivity: Human, Mouse
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Chicken
Mol.Wt.: 55kDa; 56kD(Calculated).
Uniprot: Q05940

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Monoclonal [AFfirm8107]
Specificity:
SLC18A2 Antibody detects endogenous levels of total SLC18A2.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

1110037L13Rik; 9330105E13; MGC120477; MGC120478; MGC26538; MGC90556; MNAT; Monoamine neurotransmitter transporter; Monoamine transporter; OTTHUMP00000020576; SLC18A2; Solute carrier family 18 (vesicular monoamine) member 2; Solute carrier family 18 member 2; SVAT; SVMT; Synaptic vesicle amine transporter brain; Synaptic vesicle monoamine transporter brain; Synaptic vesicular amine transporter; VAT 2; VAT2; Vesicle monoamine transporter type 2; Vesicle monoamine/H+ antiporter; Vesicular amine transporter 2; Vesicular monoamine transporter 2; VMAT 2; VMAT2; VMAT2_HUMAN;

Immunogens

Immunogen:

A synthesized peptide derived from human SLC18A2, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Description:
The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine .
Sequence:
MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKMAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD

Research Backgrounds

Function:

Involved in the ATP-dependent vesicular transport of biogenic amine neurotransmitters. Pumps cytosolic monoamines including dopamine, norepinephrine, serotonin, and histamine into synaptic vesicles. Requisite for vesicular amine storage prior to secretion via exocytosis.

Subcellular Location:

Cytoplasmic vesicle membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the major facilitator superfamily. Vesicular transporter family.

Research Fields

· Human Diseases > Neurodegenerative diseases > Parkinson's disease.

· Human Diseases > Substance dependence > Cocaine addiction.

· Human Diseases > Substance dependence > Amphetamine addiction.

· Human Diseases > Substance dependence > Alcoholism.

· Organismal Systems > Nervous system > Synaptic vesicle cycle.

· Organismal Systems > Nervous system > Serotonergic synapse.

· Organismal Systems > Nervous system > Dopaminergic synapse.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.