Product: Twist1 Antibody
Catalog: AF4009
Description: Rabbit polyclonal antibody to Twist1
Application: WB IHC IF/ICC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Chicken, Xenopus
Mol.Wt.: 29 kd; 21kD(Calculated).
Uniprot: Q15672
RRID: AB_2835337

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
Twist1 Antibody detects endogenous levels of total Twist1.
RRID:
AB_2835337
Cite Format: Affinity Biosciences Cat# AF4009, RRID:AB_2835337.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ACS3; B-HLH DNA binding protein; bHLHa38; BPES2; BPES3; Class A basic helix-loop-helix protein 38; CRS; CRS1; CSO; H-twist; OTTHUMP00000116043; SCS; TWIST; Twist basic helix loop helix transcription factor 1; Twist family bHLH transcription factor 1; Twist homolog 1 (Drosophila); Twist homolog 1; TWIST homolog of drosophila; Twist related protein 1; Twist-related protein 1; TWIST1; TWST1_HUMAN;

Immunogens

Immunogen:

A synthesized peptide derived from human Twist1, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
Q15672 TWST1_HUMAN:

Subset of mesodermal cells.

Description:
Acts as a transcriptional regulator. Inhibits myogenesis by sequestrating E proteins, inhibiting trans-activation by MEF2, and inhibiting DNA-binding by MYOD1 through physical interaction. This interaction probably involves the basic domains of both proteins. Also represses expression of proinflammatory cytokines such as TNFA and IL1B. Regulates cranial suture patterning and fusion. Activates transcription as a heterodimer with E proteins. Regulates gene expression differentially, depending on dimer composition. Homodimers induce expression of FGFR2 and POSTN while heterodimers repress FGFR2 and POSTN expression and induce THBS1 expression. Heterodimerization is also required for osteoblast differentiation.
Sequence:
MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
100
Xenopus
100
Chicken
100
Horse
0
Sheep
0
Dog
0
Zebrafish
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Acts as a transcriptional regulator. Inhibits myogenesis by sequestrating E proteins, inhibiting trans-activation by MEF2, and inhibiting DNA-binding by MYOD1 through physical interaction. This interaction probably involves the basic domains of both proteins. Also represses expression of proinflammatory cytokines such as TNFA and IL1B. Regulates cranial suture patterning and fusion. Activates transcription as a heterodimer with E proteins. Regulates gene expression differentially, depending on dimer composition. Homodimers induce expression of FGFR2 and POSTN while heterodimers repress FGFR2 and POSTN expression and induce THBS1 expression. Heterodimerization is also required for osteoblast differentiation. Represses the activity of the circadian transcriptional activator: NPAS2-ARNTL/BMAL1 heterodimer (By similarity).

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Subset of mesodermal cells.

Research Fields

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

References

1). Twist1 Regulates Vimentin through Cul2 Circular RNA to Promote EMT in Hepatocellular Carcinoma. CANCER RESEARCH, 2018 (PubMed: 29844124) [IF=12.5]

Application: IHC    Species: mouse    Sample: HCC tumor samples

(E, F) Twist1 and Vimentin expression in the tumor tissues of Twi-L+control, Twi-L+circ-10720, Twi-H+siRNA control and TwiH+si-circ-10720 groups were analyzed via IHC.

Application: WB    Species: human    Sample: HCC cells

Figure 2.| circ-10720 regulated by Twist1 exhibits oncogenic effects in HCC cells.(D) Western blot analysis of Twist1 and Cul2 protein levels in Twist1 overexpression or knockdown cells. Intensity of each band from biological triplicate experiments was quantified by densitometry with the Image J software with GAPDH as a normalizer. *P<0.05, **P<0.01, Student’s t-test.

Application: IHC    Species: human    Sample: tumor

Figure 4. |Intratumoral silencing of circ-10720 blocks the promotive effect of Twist1-mediated on Vimentin expression in a PDTX model of HCC. (E, F) Twist1 and Vimentin expression in the tumor tissues of Twi-L+control, Twi-L+circ-10720, Twi-H+siRNA control and TwiH+si-circ-10720 groups were analyzed via IHC. Each bar represents the mean ± SD for triplicate measurements of four xenografts in each group. **P<0.01, one-way ANOVA.

2). Salidroside improves the hypoxic tumor microenvironment and reverses the drug resistance of platinum drugs via HIF-1α signaling pathway. EBioMedicine, 2018 (PubMed: 30396856) [IF=9.7]

Application: WB    Species: human    Sample: PLC/PRF/5 cells

Fig. 3.|Sal reversed the drug resistance and inhibited HIF-1α signaling pathway. (I) Protein expression level of Twist1, Zeb1 and E-cadherin in PLC/PRF/5 cells treated hypoxia and hypoxia combined with Sal. Error bars represent the standard deviation of experiments performed in triplicate (*P b .05, **P b .01).

3). Prenatal co-exposure to diisodecyl phthalate and ozone contribute to depressive behavior in offspring mice through oxidative stress and TWIST1 participation. The Science of the total environment, 2024 (PubMed: 38608898) [IF=8.2]

4). A novel USP4 inhibitor that suppresses colorectal cancer stemness by promoting β-catenin and Twist1 degradation. Journal of translational medicine, 2025 (PubMed: 39856683) [IF=7.4]

5). RETRACTED ARTICLE: Hsp90β promotes aggressive vasculogenic mimicry via epithelial–mesenchymal transition in hepatocellular carcinoma. Oncogene, 2018 (PubMed: 30087438) [IF=6.9]

6). Hsp90β promotes aggressive vasculogenic mimicry via epithelial-mesenchymal transition in hepatocellular carcinoma. ONCOGENE, 2023 (PubMed: 30087438) [IF=6.9]

Application: WB    Species: human    Sample: SMMC-7721cells

Fig. 4| Hsp90β stabilize Twist1 and promotes its deubiquitination by combining with USP19. a Hsp90β knockdown decreases Twist1 stability. SMMC-7721 cells were transfected with the Hsp90βsiRNA for 24h and then were treated with CHX (100mg/ml) at the indicated time points. b SMMC-7721 cells transfected with Hsp90βsiRNA were treated with 10µM MG132 and followed by immuno-blotting using anti-Twist1 and Hsp90β.

Application: IHC    Species: human    Sample: tumor

Fig. 6 | Hsp90β promotes tumor growth and VM formation relied on Twist1 in vivo and Hsp90 inhibitor depresses the promotion effect.e, f Hsp90β, Twist1, VE-cadherin, E-cadherin, Vimentin,MMP2, and MMP9 expression levels were measured in tumor tissue of the control, Hsp90β overexpression, Hsp90β+ Twist1 siRNA,control shRNA, and Hsp90β knockdown groups by IHC.

7). Subtle structural alteration in indisulam switches the molecular mechanisms for the inhibitory effect on the migration of gastric cancer cells. Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie, 2024 (PubMed: 38359488) [IF=6.9]

Application: WB    Species: Human    Sample: AGS and MGC803 cells

Fig. 2. Compounds SR‐3‐65 and WXM‐1‐170 regulated the protein level of EMT biomarkers and transcription factors in AGS and MGC803 cells. (A, B) SR-3–65 and WXM-1–170 altered the protein level of EMT biomarkers. AGS (A) and MGC803 (B) cells were treated with DMSO, indisulam, SR-3–65, or WXM-1–170 (10 µM) for 72 h. Cell lysates were immunoblotted. Mean ± SD (n = 3). One-way ANOVA, Dunnett’s post hoc analysis, *: P < 0.05, **: P < 0.01, ***: P < 0.001, ns: not significant. (C, D) SR-3–65 and WXM-1–170 downregulated the protein level of EMT-related transcription factors. AGS (C) and MGC803 (D) cells were treated with DMSO, indisulam, SR-3–65, or WXM-1–170 (10 µM) for 72 h. Cell lysates were immunoblotted. Mean ± SD (n = 3). One-way ANOVA, Dunnett’s post hoc analysis, *: P < 0.05, **: P < 0.01, ***: P < 0.001, ****: P < 0.0001, ns: not significant.

8). Molecular mechanism of albumin in suppressing invasion and metastasis of hepatocellular carcinoma. LIVER INTERNATIONAL, 2022 (PubMed: 34854209) [IF=6.0]

Application: WB    Species: Human    Sample: HepG2 and Huh7 cells

FIGURE 7 A, Representative images of the western blot results for uPAR, MMP2 and MMP9 in ALB knockdown HepG2 and Huh7 cells; B, Zymography analysis illustrates MMP2 and MMP9 activity in ALB knockdown HepG2 and Huh7 cells; C, Quantitative analysis results and representative images of the western blot results for the EMT‐associated markers, E‐cadherin, N‐cadherin, vimentin, Snail and Twist by western blot in ALB knockdown HepG2 and Huh7 cells; D, Quantification shows a significantly higher uPAR in HCC group with ALB <3.5 g/dL compared to ALB ≥3.5 g/dL (*P < .05); E, Scatterplot showing the correlation between plasma levels of ALB and uPAR. The vertical position represents the expression levels of uPAR (lg pg/mL)

9). LINC00909 up-regulates pluripotency factors and promotes cancer stemness and metastasis in pancreatic ductal adenocarcinoma by targeting SMAD4. Biology direct, 2024 (PubMed: 38504385) [IF=5.5]

Application: WB    Species: Human    Sample: PDAC cells

Fig. 3. LINC00909 is associated with the MAPK/JNK pathway and pluripotency factors in pancreatic ductal adenocarcinoma (PDAC). (A) Gene Ontology (GO) enrichment analysis of LINC00909 based on the NGS database. (B) Top 15-enriched Kyoto Encyclopedia of Genes and Genomes (KEGG) pathways of LINC00909 based on the NGS database. (C) Gene set enrichment analysis (GSEA) of the NGS database. (D) The expression of factors associated with stemness and metastasis was analyzed by NGS using PANC-1/Vector and PANC-1/LINC00909-OE cells. These factors are shown in the heatmap. (E–G) Western blotting analysis was conducted to detect the protein expression of JNK phospho-JNK, c-JUN, phospho-JUN, TWIST, and SNAIL in LINC00909-overexpressing cells (E) and LINC00909-knockdown cells (F, G). All *P 

10). Phenylpropenol ester and sesquiterpenoids with antimetastatic activities from the whole plants of Chloranthus japonicus. Arabian Journal of Chemistry, 2022 [IF=5.3]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.