Twist2 Antibody - #AF4112

Product: | Twist2 Antibody |
Catalog: | AF4112 |
Description: | Rabbit polyclonal antibody to Twist2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
Mol.Wt.: | 18kd; 18kD(Calculated). |
Uniprot: | Q8WVJ9 |
RRID: | AB_2835360 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF4112, RRID:AB_2835360.
Fold/Unfold
bHLHa39; Class A basic helix-loop-helix protein 39; Dermis expressed protein 1; Dermis-expressed protein 1; DERMO 1; Dermo-1; DERMO1; MGC117334; Twist 2; Twist homolog 2 (Drosophila); Twist homolog 2; Twist related bHLH protein Dermo1; Twist related protein 2; Twist-related protein 2; Twist2; TWST2_HUMAN;
Immunogens
In the embryo, highly expressed in chondrogenic cells. In embryonic skin, expressed in the undifferentiated mesenchymal layer beneath the epidermis which later develops into the dermis. Expressed in early myeloid cells but not in lymphoid cells in the liver. Expression also detected in the secretory ependymal epithelium of the choroid plexus primordium. In the adult, expressed in secreting glandular tissues and tubules.
- Q8WVJ9 TWST2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8WVJ9 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S55 | Phosphorylation | Uniprot | |
S60 | Phosphorylation | Uniprot | |
S66 | Phosphorylation | Uniprot | |
T95 | Phosphorylation | Uniprot | |
K100 | Ubiquitination | Uniprot | |
S102 | Phosphorylation | Uniprot | |
K103 | Ubiquitination | Uniprot |
Research Backgrounds
Binds to the E-box consensus sequence 5'-CANNTG-3' as a heterodimer and inhibits transcriptional activation by MYOD1, MYOG, MEF2A and MEF2C. Also represses expression of proinflammatory cytokines such as TNFA and IL1B. Involved in postnatal glycogen storage and energy metabolism (By similarity). Inhibits the premature or ectopic differentiation of preosteoblast cells during osteogenesis, possibly by changing the internal signal transduction response of osteoblasts to external growth factors.
Nucleus. Cytoplasm.
Note: Mainly nuclear during embryonic development. Cytoplasmic in adult tissues.
In the embryo, highly expressed in chondrogenic cells. In embryonic skin, expressed in the undifferentiated mesenchymal layer beneath the epidermis which later develops into the dermis. Expressed in early myeloid cells but not in lymphoid cells in the liver. Expression also detected in the secretory ependymal epithelium of the choroid plexus primordium. In the adult, expressed in secreting glandular tissues and tubules.
Efficient DNA binding requires dimerization with another bHLH protein. Forms a heterodimer with TCF3/E12. Also interacts with MEF2C (By similarity).
Research Fields
· Human Diseases > Cancers: Overview > Proteoglycans in cancer.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.