Product: ST3GAL4 Mouse Monoclonal Antibody
Catalog: BF8814
Description: Mouse monoclonal antibody to ST3GAL4
Application: WB
Reactivity: Human, Mouse
Prediction: Rat
Mol.Wt.: 35-40kD(Observed); 38kD(Calculated).
Uniprot: Q11206

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse IgG
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse
Clonality:
Monoclonal [AFfirm8814]
Specificity:
ST3GAL4 Mouse Monoclonal Antibody detects endogenous levels of ST3GAL4.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Alpha 2 3 sialyltransferase IV; Alpha 2 3 ST; Alpha 3 N acetylneuraminyltransferase; Beta galactoside alpha 2 3 sialyltransferase; CGS23; CMP N acetylneuraminate beta galactosamide alpha 2 3 sialyltransferase; FLJ11867; FLJ46764; Gal NAc6S; NANTA3; SAT 3; SAT3; Sialyltransferase 4C (beta galactosidase alpha 2 3 sialytransferase); Sialyltransferase 4C (beta galactoside alpha 2 3 sialytransferase); SIAT4; SIAT4 C; SIAT4C; ST 4; ST3 beta galactoside alpha 2 3 sialyltransferase 4; ST3Gal III; ST3GAL4; ST3GalIV; ST4; STZ;

Immunogens

Immunogen:

A synthesized peptide derived from human ST3GAL4.

Uniprot:
Gene(ID):
Expression:
Q11206 SIA4C_HUMAN:

Highly expressed in adult placenta, ovary and testes.

Sequence:
MVSKSRWKLLAMLALVLVVMVWYSISREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF

Research Backgrounds

Function:

Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, and NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. It may be involved in the biosynthesis of the sialyl Lewis X determinant.

PTMs:

The soluble form derives from the membrane form by proteolytic processing.

Subcellular Location:

Golgi apparatus>Golgi stack membrane>Single-pass type II membrane protein. Secreted.
Note: Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly expressed in adult placenta, ovary and testes.

Family&Domains:

Belongs to the glycosyltransferase 29 family.

Research Fields

· Metabolism > Glycan biosynthesis and metabolism > Glycosphingolipid biosynthesis - lacto and neolacto series.

· Metabolism > Global and overview maps > Metabolic pathways.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.