AFfirm™ B4GALT1 Mouse Monoclonal Antibody - #BF9345

Product: B4GALT1 Mouse Monoclonal Antibody
Catalog: BF9345
Description: Mouse monoclonal antibody to B4GALT1
Application: WB
Reactivity: Human
Prediction: Mouse, Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 43 KD; 44kD(Calculated).
Uniprot: P15291

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFfirm9345]
Specificity:
B4GALT1 Mouse Monoclonal Antibody detects endogenous levels of total B4GALT1.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

384.Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase; 4-galactosyltransferase 1; 4-GalTase 1; b4Gal-T1; B4galt1; B4GT1_HUMAN; Beta-1; Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase; Beta4Gal-T1; CDG2D; GGTB2; GT1; GTB; Lactose synthase A protein; N-acetyllactosamine synthase; Nal synthase; Processed beta-1; UDP-Gal:beta-GlcNAc beta-1; UDP-galactose:beta-N-acetylglucosamine beta-1;

Immunogens

Immunogen:
Uniprot:

P15291(B4GT1_HUMAN) >>Visit HPA database.

Gene(ID):
B4GALT1(2683)
Expression:
P15291 B4GT1_HUMAN:

Ubiquitously expressed, but at very low levels in fetal and adult brain.

Sequence:
MRLREPLLSGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLSRLPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS

PTMs - P15291 As Substrate

Site PTM Type Enzyme
S73 Phosphorylation
S74 Phosphorylation
R204 Methylation
S270 Phosphorylation
S344 Phosphorylation
S373 Phosphorylation

Research Backgrounds

Function:

The Golgi complex form catalyzes the production of lactose in the lactating mammary gland and could also be responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids.

The cell surface form functions as a recognition molecule during a variety of cell to cell and cell to matrix interactions, as those occurring during development and egg fertilization, by binding to specific oligosaccharide ligands on opposing cells or in the extracellular matrix.

PTMs:

The soluble form derives from the membrane forms by proteolytic processing.

Subcellular Location:

Golgi apparatus>Golgi stack membrane>Single-pass type II membrane protein. Cell membrane>Single-pass type II membrane protein. Cell surface. Cell projection>Filopodium.
Note: Found in trans cisternae of Golgi but is mainly localized at the plasma membrane (PubMed:1714903). B4GALT1 cell surface expression is regulated by UBE2Q1 (By similarity).

Golgi apparatus>Golgi stack membrane>Single-pass type II membrane protein.
Note: Found in trans cisternae of Golgi.

Secreted.
Note: Soluble form found in body fluids.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitously expressed, but at very low levels in fetal and adult brain.

Subunit Structure:

Homodimer; and heterodimer with alpha-lactalbumin to form lactose synthase. Interacts (via N-terminal cytoplasmic domain) with UBE2Q1 (via N-terminus); the interaction is direct (By similarity).

Family&Domains:

Belongs to the glycosyltransferase 7 family.

Research Fields

· Metabolism > Carbohydrate metabolism > Galactose metabolism.

· Metabolism > Glycan biosynthesis and metabolism > N-Glycan biosynthesis.

· Metabolism > Glycan biosynthesis and metabolism > Other types of O-glycan biosynthesis.

· Metabolism > Glycan biosynthesis and metabolism > Glycosaminoglycan biosynthesis - keratan sulfate.

· Metabolism > Glycan biosynthesis and metabolism > Glycosphingolipid biosynthesis - lacto and neolacto series.

· Metabolism > Global and overview maps > Metabolic pathways.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.