| Product: | NBL1 Antibody |
| Catalog: | DF3177 |
| Description: | Rabbit polyclonal antibody to NBL1 |
| Application: | WB IHC IF/ICC |
| Cited expt.: | IF/ICC |
| Reactivity: | Human, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog |
| Mol.Wt.: | 19 KD(Observed); 19kD(Calculated). |
| Uniprot: | P41271 |
| RRID: | AB_2835400 |
Control Products
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3177, RRID:AB_2835400.
Fold/Unfold
D1S1733E; DAN; DAN domain family member 1; DAND 1; DAND1; Differential screening selected gene aberrant in neuroblastoma; MGC8972; NB; NBL 1; Neuroblastoma candidate region suppression of tumorigenicity 1; Neuroblastoma suppression of tumorigenicity 1; Neuroblastoma suppressor of tumorigenicity 1; NO 3; NO3; Zinc finger protein DAN;
Immunogens
A synthesized peptide derived from human NBL1, corresponding to a region within C-terminal amino acids.
- P41271 NBL1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Possible candidate as a tumor suppressor gene of neuroblastoma. May play an important role in preventing cells from entering the final stage (G1/S) of the transformation process.
Secreted.
Most abundant in normal lung and meningioma.
Belongs to the DAN family.
Research Fields
· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway. (View pathway)
References
Application: IF/ICC Species: human Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.