Product: CBR1 Mouse Monoclonal Antibody
Catalog: BF9392
Description: Mouse monoclonal antibody to CBR1
Application: WB
Reactivity: Human
Prediction: Mouse, Rat, Chicken
Mol.Wt.: 30kDa; 30kD(Calculated).
Uniprot: P16152

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFfirm9392]
Specificity:
CBR1 Mouse Monoclonal Antibody detects endogenous levels of total CBR1.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

15 hydroxyprostaglandin dehydrogenase [NADP+]; 15-hydroxyprostaglandin dehydrogenase [NADP+]; Carbonyl reductase [NADPH] 1; Carbonyl Reductase 1; CBR 1; CBR1; CBR1_HUMAN; CRN; NADPH dependent carbonyl reductase 1; NADPH-dependent carbonyl reductase 1; Prostaglandin 9 ketoreductase; Prostaglandin 9-ketoreductase; Prostaglandin E(2) 9 reductase; Prostaglandin-E(2) 9-reductase; SDR21C1;

Immunogens

Immunogen:

A synthesized peptide derived from human CBR1, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Description:
The protein encoded by this gene belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics. Alternatively spliced transcript variants have been found for this gene.
Sequence:
MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

Research Backgrounds

Function:

NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the short-chain dehydrogenases/reductases (SDR) family.

Research Fields

· Human Diseases > Cancers: Overview > Chemical carcinogenesis.

· Metabolism > Lipid metabolism > Arachidonic acid metabolism.

· Metabolism > Metabolism of cofactors and vitamins > Folate biosynthesis.

· Metabolism > Xenobiotics biodegradation and metabolism > Metabolism of xenobiotics by cytochrome P450.

· Metabolism > Global and overview maps > Metabolic pathways.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.