Product: M-CK Mouse Monoclonal Antibody
Catalog: BF9462
Description: Mouse monoclonal antibody to M-CK
Application: WB
Reactivity: Human
Prediction: Mouse, Rat, Pig, Bovine, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 43 KD; 43kD(Calculated).
Uniprot: P06732

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFfirm9462]
Specificity:
M-CK Mouse Monoclonal Antibody detects endogenous levels of total M-CK.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CKM; CKMM; Creatine kinase M; Creatine kinase M chain; Creatine kinase M type; Creatine kinase M-type; Creatine kinase muscle; Creatine kinase, muscle type; KCRM_HUMAN; M-CK; MCK; Muscle creatine kinase;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

PTMs - P06732 As Substrate

Site PTM Type Enzyme
Y14 Phosphorylation
Y20 Phosphorylation
S24 Phosphorylation
T35 Phosphorylation
Y39 Phosphorylation
K40 Acetylation
K41 Acetylation
Y125 Phosphorylation
S128 Phosphorylation
S129 Phosphorylation
S136 Phosphorylation
Y140 Phosphorylation
T141 Phosphorylation
S164 Phosphorylation
T166 Phosphorylation
K170 Acetylation
Y173 Phosphorylation
Y174 Phosphorylation
S178 Phosphorylation
T180 Phosphorylation
S199 Phosphorylation
R215 Methylation
S224 Phosphorylation
K247 Acetylation
K265 Acetylation
Y279 Phosphorylation
T313 Phosphorylation
T322 Phosphorylation
T327 Phosphorylation
S332 Phosphorylation
K365 Acetylation
S372 Phosphorylation

Research Backgrounds

Function:

Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Dimer of identical or non-identical chains, which can be either B (brain type) or M (muscle type). With MM being the major form in skeletal muscle and myocardium, MB existing in myocardium, and BB existing in many tissues, especially brain.

Family&Domains:

Belongs to the ATP:guanido phosphotransferase family.

Research Fields

· Metabolism > Amino acid metabolism > Arginine and proline metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.